Лариса серебрякова: лариса серебрякова | Facebook


Содержание

Публикации: Серебрякова Лариса Ивановна | Научно-инновационный портал СФУ

  1. Выбор оптимальных параметров термообработки автомобильных дисков колес из сплава A356.0 [доклад, тезисы доклада, статья из сборника материалов конференций]Абалымов В. Р., Клейменов Ю. А., Дроздова Т. Н., Серебрякова Л. И., Уральский федеральный университет имени первого Президента России Б. Н. Ельцина, Научно-образовательный центр «Новые металлосодержащие материалы и технологии металлургии»; Институт физики металлов УрО РАН

    2013, XIV Международная научно-техническая Уральская школа-семинар металловедов — молодых ученых

    присутствует в РИНЦ (eLIBRARY.RU)

  2. СИСТЕМА МЕНЕДЖМЕНТА КАЧЕСТВА В ИЗДАТЕЛЬСКО-ПОЛИГРАФИЧЕСКОМ КОМПЛЕКСЕ [статья из журнала]

    2013, Сертификация

    присутствует в РИНЦ (eLIBRARY.RU)

  3. ВНЕДРЕНИЕ СМК В ЛОГИСТИЧЕСКОЙ КОМПАНИИ [статья из журнала]

    2013, Сертификация

    присутствует в РИНЦ (eLIBRARY.RU)

  4. ПРИМЕНЕНИЕ СТАТИСТИЧЕСКИХ МЕТОДОВ ДЛЯ УПРАВЛЕНИЯ ТЕХНОЛОГИЧЕСКИМИ ПРОЦЕССАМИ [статья из журнала]

    2012, Сертификация

    присутствует в РИНЦ (eLIBRARY.RU)

  5. Основы метрологии : учеб. пособие для студентов технических специальностей [монография]

    2006

    присутствует в РИНЦ (eLIBRARY.RU)

  6. Взаимодействие золота с полупроводниковыми материалами [монография]

    2006

    присутствует в РИНЦ (eLIBRARY.RU) (1 цит.)

  7. Профессионализм сотрудников — основа инновационной деятельности организации [статья из журнала]

    2006, Современные проблемы науки и образования

    присутствует в РИНЦ (eLIBRARY.RU) (1 цит.), Список ВАК

  8. Формирование требований к профессиональной компетентности кандидата в процессе отбора персонала в ОАО «Красцветмет» [статья из журнала]

    2006, Современные проблемы науки и образования

    присутствует в РИНЦ (eLIBRARY.RU), Список ВАК

  9. Германий, его соединения и сплавы : монография [монография]

    2002

    присутствует в РИНЦ (eLIBRARY.RU) (36 цит.)

  10. Density and surface tension of fused systems of Bi2O3-V2O5, Bi2O3-TiO2 and Bi2O3-B2O3 : научное издание [статья из журнала]

    2001, Расплавы

    присутствует в РИНЦ (eLIBRARY.RU), Ядро РИНЦ (eLIBRARY.RU), Список ВАК

  11. Effect of copper, iron and nickel oxides on surface tension and density of bismuth oxide : научное издание [статья из журнала]

    2001, Расплавы

    присутствует в РИНЦ (eLIBRARY.RU), Ядро РИНЦ (eLIBRARY.RU), Список ВАК

Информация о публикациях загружается с сайта службы поддержки публикационной активности СФУ. Там же сотрудники СФУ могут смотреть и редактировать списки своих публикаций. Сообщите, если заметили неточности.

Кафедра ИГиП : АлтГТУ

Образование: АГУ, 1989 г специальность «История», 2000 г. ААЭиП  специальность «Юриспруденция»

Стаж работы в АлтГТУ 25 лет.

Преподаваемые учебные курсы:  «Правовое регулирование предпринимательской деятельности», «Гражданское право», «Правовые основы предпринимательской деятельности», «Правоведение», «Предпринимательское право».

Серебрякова Л.Г. активно сотрудничает с Факультетом повышения квалификации и переподготовки руководителей и специалистов в реализации программ повышения квалификации «Организация перевозок автомобильным транспортом», профессиональной переподготовки «Оценка стоимости предприятия»

Серебрякова Л.Г. является практикующим юристом, осуществляет правовое сопровождение бизнеса организаций торговли, строительства, перерабатывающей промышленности, текстильного производства, внешнеэкономической деятельности российских компаний. Практические знания использует в преподавательской деятельности.

В 2014−2016 гг. участвовала в реализации инвестиционных проектов по модернизации трикотажного и швейного производства (ООО «Спецобъединение-Сибирь», ООО «Спец-Алтай»), осуществляемых при поддержке Администрации Алтайского края.

В 2018 году принимала участие в реализации проекта «Технология создания собственного дела», ставшего победителем конкурсного отбора операторов федеральной программы «Ты – предприниматель» Управления молодежной политики и реализации программ общественного развития Алтайского края и Управления Алтайского края по развитию предпринимательства и рыночной инфраструктуры.

Статьи:

1. Серебрякова Л.Г. Проблемы независимой оценки качества образования в вузе (правовой аспект). / Гарантии качества профессионального образования». Тезисы докладов Международной научно-практической конференции. – Барнаул: Изд-во АлтГТУ, 2015. – С. 88–90.

2. Серебрякова Л.Г.,Стеклянникова Я.Ю.,Ступина А.О. Право на труд и свобода труда. // Студенческая наука в условиях формирования единого научного и образовательного пространства: Материалы V Международной научно-практической конференции студентов и молодых ученых, г. Усть-Каменогорск, Казахстан, 16 марта 2018 г. –с. 1267−1275.

3. Щербинина  Л.Ф., Акимова И.Л., Кузьменко К.А., Серебрякова Л.Г. Парламентский контроль в юридическом образовании: концептуально-праксиологический аспект / Л.Ф. Щербинина, И.Л. Акимова, К.А. Кузьменко, Л.Г. Серебрякова // Философия образования. – 2016. – № 4 (67). – С. 38−47.

(научная статья, № 1347 в перечне ВАК).

4. Бровкина М.Д., Иванова Е.А.,  Серебрякова Л.Г. К вопросу о правовом регулировании инновационной деятельности в Российской Федерации.// Материалы XV Всероссийской научно-технической конференции студентов, аспирантов и молодых ученых «Наука и молодежь». 2019 г. – с. 267−270.

5. Овчинников Я.Л., Серебрякова Л.Г. Типовые нарушения, выявленные экспертами при проведении государственной аккредитации образовательных организаций. // Гарантии качества профессионального образования: материалы Международной научно-практической конференции. Барнаул: Изд-во АлтГУ, 2019 г. С. 22−26.

Награды:

2006 г. Почетная грамота управления Алтайского края по образованию и делам молодежи

2015 г. Почетная грамота администрации г. Барнаула  

Кордюкова Лариса Валентиновна — пользователь, сотрудник

Кордюкова Лариса Валентиновна — пользователь, сотрудник | ИСТИНА – Интеллектуальная Система Тематического Исследования НАукометрических данных

Кордюкова Лариса Валентиновна пользователь ответственный

МГУ имени М.В. Ломоносова, Научно-исследовательский институт физико-химической биологии имени А.Н.Белозерского, Отдел хроматографического анализа, ведущий научный сотрудник, с 13 августа 1984
доктор биологических наук с 2014 года
кандидат биологических наук с 1991 года
МГУ имени М.В. Ломоносова, Научно-исследовательский институт физико-химической биологии имени А.Н.Белозерского, Отдел хроматографического анализа, ответственный по системе
Соавторы: Серебрякова М.В., Баратова Л.А., Ксенофонтов А.Л., Veit M., Федорова Н.В., Бадун Г.А., Khrustalev V., Минтаев Р.Р., Khrustaleva T., Алексеевский А.В., Филиппова И.Ю., Штыкова Э.В., Абрамчук С.С. показать полностью…, Марголис Л.Б., Овчинникова Т.В., Побойнев В.В., Brett K., TORCHILIN V., Петухов М.В., Смирнова Ю.А., Ivanova V.T., Kropotkina E.A., Siche S., Лукашина Е.В., Маркушин С.Г., Bogacheva E.N., Herrmann A., Markushin S.G., Rudneva I.A., Shishkov A.V., Slepushkin A.N., Thaa B., Vaskovsky B.V., Арутюнян А.М., Арутюнян А.М., Байбаков Б.А., Батищев О.В., Богачева Е.Н., Лысогорская Е.Н., Моисеенко А.В., Радюхин В.А., Krabben L., Manykin A.A., Moeller L., Oskerko T.A., Rakutina R.O., Ахметова А.И., Баландина Г.Н., Бачева А.В., Бурцева Е.И., Громова Е.С., Добров Е.Н., Друца В.Л., Кирсанова О.В., Кузнецова М.А., Пеков Ю.А., Свергун Д.И., Синицына О.В., Скурат Е.В., Смирнова А.В., Сошинская Е.Ю., Ташлицкий В.Н., Телеман А.A., Яминский И.В., ANISCHUK M., Akimov S.S., Akunevich A.A., BELIZER N., Bandarenka H., Brügger B., Cherkasov E.G., Chulichkov A., Dolgov A., Engel S., Feodoritova E.L., Ferrer-Caelles A., Freund C., Gadalla M.R., Girel K., Hass J.R., Kahanouskaya E., Katharina B., Khinevich N., Knyazev D.G., Laue M., Levental I., Loshkarev N.A., Lüchtenborg C., Merkulova L.N., Miller A.K., Mirsky V.M., Nůsková H., Polyansky A.A., Popov K.V., Prudovsky I.A., Rudnichenko Y., Sachsenheimer T., Shanko A.V., Stojarov A.N., Tsybalova L., Yaminsky D.I., Zabrodskaya Y.A., Zagorskaia I.V., Александров В.Б., Анашкин В.А., Арсеньев А.С., Богданов, мл. А.А., Василькова Д.П., Воронина О.Л., Дадинова Л.А., Долинная Н.Г., Ефремов Р.Г., Завьялова Е.Г., Иванова В.Т., Козловский В.С., Конарев П.В., Королева О.Н., Кропоткина Е.А., Лавренова Г.И., Люкманова Е.Н., Марьясина С.С., Минеев К.С., Нускова Х., Поляков В.Ю., Полянский А.А., Родина Е.В., Ртищев А.А., Семашко Т.А., Сергиев П.В., Серебрякова Л.В., Спиридонова В.А., Степанова Л.А., Сумбатян Н.В., Терещенков А.Г., Тимофеева А.В., Тимофеева Т.А., Трушакова С.В., Файт М., Цетлин В.И., Чайлахян Л.М., Шалджян А.А., Шанько А.В., Шаровская Ю.Ю., Шевченко Е.С., Шулепко М.А., Яминский Д.
72 статьи, 3 книги, 26 докладов на конференциях, 24 тезисов докладов, 17 НИР, 1 членство в научном обществе, 1 членство в редколлегии журнала, 3 членства в программных комитетах, 2 диссертации, 1 дипломная работа, 4 учебных курса
Количество цитирований статей в журналах по данным Web of Science: 435, Scopus: 431

IstinaResearcherID (IRID): 380181
ResearcherID: D-6547-2012
ORCID: 0000-0002-6089-1103

Деятельность


  • Статьи в журналах
      • 2021 Stearic acid blunts growth-factor signaling via oleoylation of GNAI proteins
      • Nůsková Hana, Serebryakova Marina V., Ferrer-Caelles Anna, Sachsenheimer Timo, Lüchtenborg Christian, Miller Aubry K., Brügger Britta, Kordyukova Larisa V., Teleman Aurelio A.
      • в журнале Nature communications, издательство Nature Pub. Group (United Kingdom), том 12, № 1 DOI
      • 2021 The Structure of the Potato Virus A Particles Elucidated by Small Angle X-Ray Scattering and Complementary Techniques
      • Shtykova Eleonora V., Petoukhov Maxim V., Fedorova Natalia V., Arutyunyan Alexander M., Skurat Eugene V., Kordyukova Larisa V., Moiseenko Andrey V., Ksenofontov Alexander L.
      • в журнале Biochemistry (Moscow), издательство Pleiades Publishing, Ltd (Road Town, United Kingdom), том 86, № 2, с. 230-240 DOI
      • 2021 The cytoplasmic tail of Influenza A virus hemagglutinin and membrane lipid composition change the mode of M1 protein association with the lipid bilayer
      • Kordyukova Larisa V., Konarev Petr V., Fedorova Nataliya V., Shtykova Eleonora V., Ksenofontov Aleksander L., Loshkarev Nikita A., Dadinova Lubov A., Timofeeva Tatyana A., Abramchuk Sergei S., Moiseenko Andrei V., Baratova Lyudmila A., Svergun Dmitri I., Batishchev Oleg V.
      • в журнале Membranes, издательство MDPI Publishing (Basel, Switzerland, Switzerland)
      • 2021 Структура вирионов A-вируса картофеля по данным малоуглового рентгеновского рассеяния и комплементарных методов
      • Штыкова Э.В., Петухов М.В., Федорова Н.В., Арутюнян А.М., Скурат Е.В., Кордюкова Л.В., Моисеенко А.В., Ксенофонтов А.Л.
      • в журнале Биохимия, издательство ИКЦ «Академкнига» (Москва), том 86, № 2, с. 274-287 DOI
      • 2020 Comparative Immunological Study in Mice of Inactivated Influenza Vaccines Used in the Russian Immunization Program
      • Shanko Andrei, Shuklina Marina, Kovaleva Anna, Zabrodskaya Yana, Vidyaeva Inna, Shaldzhyan Aram, Fadeev Artem, Korotkov Alexander, Zaitceva Marina, Stepanova Liudmila, Tsybalova Liudmila, Kordyukova Larisa, Katlinski Anton
      • в журнале VACCINES, том 8, № 4, с. 756 DOI
      • 2020 Filamentous versus Spherical Morphology: A CaseStudy of the Recombinant A/WSN/33 (h2N1) Virus
      • Kordyukova Larisa V., Mintaev Ramil R., Rtishchev Artyom A., Kunda Marina S., Ryzhova Natalia N., Abramchuk Sergei S., Serebryakova Marina V., Khrustalev Vladislav V., Khrustaleva Tatyana A., Poboinev Victor V., Markushin Stanislav G., Voronina Olga L.
      • в журнале Microscopy and Microanalysis, издательство Cambridge University Press (United Kingdom), том 26, № 2, с. 297-309 DOI
      • 2019 Structural study of Influenza virus hemagglutinin C-terminal region
      • Khrustalev V.V., Khrustaleva T.A., Arutyunyan A.M., Shtykova E.V., Petoukhov M.V., Fedorova N.V., Poboinev V.V., Kordyukova L.V.
      • в журнале FEBS open bio, издательство John Wiley & Sons Inc. (United States), том 9, № Suppl. 1, с. 253-253 DOI
      • 2018 The alpha helix 1 from the first conserved region of HIV1 gp120 is reconstructed in the short NQ21 peptide
      • Khrustalev VV, Khrustaleva TA, Kahanouskaya EY, Rudnichenko YA, Bandarenka HV, Arutyunyan AM, Girel KV, Khinevich NV, Ksenofontov AL, Kordyukova LV
      • в журнале Archives of Biochemistry and Biophysics, издательство Academic Press (United States), том 638, с. 66-75 DOI
      • 2016 Acylation of influenza virus membrane proteins: biochemistry and function
      • Brett K., Siche S., Wang M.Y., Thaa B., Herrmann A., Kordyukova L., Veit M.
      • в журнале Amino Acids, издательство Springer Verlag (Germany), том 48, № 2, с. 618-618 DOI
      • 2015 Two Cytoplasmic Acylation Sites and an Adjacent Hydrophobic Residue, but No Other Conserved Amino Acids in the Cytoplasmic Tail of HA from Influenza A Virus Are Crucial for Virus Replication
      • Siche S., Brett K., Möller L., Kordyukova L.V., Mintaev R.R., Alexeevsky A.V., Veit M.
      • в журнале Viruses, издательство MDPI (Basel, Switzerland), том 7, № 12, с. 6458-6475 DOI
      • 2013 Structural investigation of influenza virus hemagglutinin membrane-anchoring peptide
      • Mineev Konstantin S., Lyukmanova Ekaterina N., Krabben Ludwig, Serebryakova Marina V., Shulepko Mikhail A., Arseniev Alexander S., Kordyukova Larisa V., Veit Michael
      • в журнале Protein Engineering, Design and Selection, издательство Oxford University Press (United Kingdom), том 26, № 9, с. 547-552 DOI
      • 2011 Influenza virus hemagglutinin spike neck architectures and interaction with model enzymes evaluated by MALDI-TOF mass spectrometry and bioinformatics tools
      • Serebryakova M.V., Kordyukova L.V., Semashko T.A., Ksenofontov A.L., Rudneva I.A., Kropotkina E.A., Filippova I.Y., Veit M., Baratova L.A.
      • в журнале Virus Research, издательство Elsevier BV (Netherlands), том 160, № 1-2, с. 294-304 DOI
      • 2011 Linker and/or transmembrane regions of influenza A/Group-1, A/Group-2, and type B virus hemagglutinins are packed differently within trimers
      • Kordyukova L.V., Serebryakova M.V., Polyansky A.A., Kropotkina E.A., Alexeevski A.V., Veit M., Efremov R.G., Filippova I.Y., Baratova L.A.
      • в журнале Biochimica et Biophysica Acta — Biomembranes, издательство Elsevier BV (Netherlands), том 1808, № 7, с. 1843-1854 DOI
      • 2009 The In Situ Structural Characterization of the Influenza A Virus Matrix M1 Protein within a Virion
      • Shishkov Alexander V., Bogacheva Elena N., Dolgov Alexey A., Chulichkov Alexey L., Knyazev Denis G., Fedorova Natalia V., Ksenofontov Alexander L., Kordyukova Larisa V., Lukashina Elena V., Mirsky Vladimir M., Baratova Lyudmila A.
      • в журнале Protein and Peptide Letters, издательство Bentham Science Publishers (Netherlands), том 16, № 11, с. 1407-1413 DOI
      • 2008 Influenza A virus M1 protein structure probed by in situ limited proteolysis with bromelain
      • Kordyukova L.V., Serebryakova M.V., Polyakov V.Y., Ovchinnikova T.V., Smirnova Yu A., Fedorova N.V., Baratova L.A.
      • в журнале Protein and Peptide Letters, издательство Bentham Science Publishers (Netherlands), том 15, № 9, с. 922-930 DOI
      • 2007 Isolation of the influenza a HA2 C-terminal segment by combination of nonionic detergents
      • Smirnova Y.A., Fedorova N.V., Serebryakova M.V., Kordyukova L.V., Ksenofontov A.L., Radyukhin V.A., Vaskovsky B.V., Baratova A.
      • в журнале Biopolymers, издательство John Wiley & Sons Inc. (United States), том 88, № 4, с. 589-589
      • 2006 [Internal epidemic influenza virus proteins: isolation and investigation]
      • Ivanova V.T., Rakutina R.O., Kordiukova L.V., Manykin A.A., Fedorova N.V., Ksenofontov A.L., Slepushkin A.N.
      • в журнале Voprosy Virusologii, издательство Meditsina Publishers (Russian Federation), том 51, № 2, с. 22-6
      • 2006 [The properties of the epidemic influenza viruses A and B strains circulating in Russia in the 2004-2005 epidemic season]
      • Ivanova V.T., Rakutina R.O., Slepushkin A.N., Burtseva E.I., Oskerko T.A., Shevchenko E.S., Fedorova N.V., Kordiukova L.V., Trushakova S.V., Cherkasov E.G., Merkulova L.N., Feodoritova E.L.
      • в журнале Voprosy Virusologii, издательство Meditsina Publishers (Russian Federation), том 51, № 6, с. 27-30
      • 2003 [The use of bromelain in obtaining the subviral particles of influenza A and B viruses]
      • Ivanova V.T., Kordiukova L.V., Manykin A.A., Burtseva E.I., Zagorskaia Iu V., Oskerko T.A., Slepushkin A.N.
      • в журнале Voprosy Virusologii, издательство Meditsina Publishers (Russian Federation), том 48, № 5, с. 14-8
      • 2002 Studying the spatial organization of membrane proteins by means of tritium stratigraphy: bacteriorhodopsin in purple membrane
      • Shishkov A.V., Ksenofontov A.L., Bogacheva E.N., Kordyukova L.V., Badun G.A., Alekseevsky A.V., Tsetlin V.I., Baratova L.A.
      • в журнале Bioelectrochemistry, издательство Elsevier BV (Netherlands), том 56, № 1-2, с. 147-149 DOI
  • Статьи в сборниках
      • 2004 Influenza A hemagglutinin C-terminal anchoring peptide. MS identification and approach to structural study
      • Kordyukova L.V., Serebryakova M.V., Ovchinnikova T.V., Ivanova V.T., Baratova L.A.
      • в сборнике Peptides-2004, серия Proceedings of the 3rd International and 28th European Peptide Symposium. Prague (Czech Rep.), место издания Kenes International Tel-Aviv. Israel. Eds.: M. Flegel, M. Fridkin, C. Gilon, J. Slaninova, с. 435-436
  • Книги
      • 2021 Экспериментальные методы исследования белков и нуклеиновых кислот». Раздел I. Отдельные короткие задачи по выбору. Учебно-методическая разработка к спецпрактикуму по биоорганической химии
      • Бачева А.В., Баратова Л.А., Радюхин В.А., Федорова Н.В., Серебрякова М.В., Ксенофонтов А.Л., Ташлицкий В.Н., Василькова Д.П., Баландина Г.Н., Громова Е.С., Кирсанова О.В., Долинная Н.Г., Филиппова И.Ю., Марьясина С.С., Кордюкова Л.В., Сумбатян Н.В., Терещенков А.Г., Спиридонова В.А., Родина Е.В., Анашкин В.А., Завьялова Е.Г.
      • место издания МДМ-принт Москва, Россия, 127 с.
      • 2009 Экспериментальные методы исследования белков и нуклеиновых кислот». Раздел I. Общий практикум.Методические разработки к спецпрактикуму по химии белка, нуклеиновых кислот и нуклеопротеидов
      • Баландина Г.Н., Лавренова Г.И., Баратова Л.А., Ташлицкий В.Н., Сергиев П.В., Громова Е.С., Кирсанова О.В., Филиппова И.Ю., Бачева А.В., Королева О.Н., Кордюкова Л.В., Серебрякова Л.В., Лукашина Е.В.
      • место издания Отдел оперативной печати и информации химического факультета МГУ имени М.В. Ломоносова Москва, 83 с.
  • Доклады на конференциях
      • 2019 Structural study of Influenza virus hemagglutinin C-terminal region (Стендовый)
      • Авторы: Khrustalev V.V., Khrustaleva T.A., Arutyunyan A.M., Shtykova E.V., Petoukhov M.V., Fedorova N.V., Poboinev V.V., Kordyukova L.V.
      • FEBS 2019, г. Краков, Польша, 6-11 июля 2019
      • 2018 Filamentous morphology of recombinant Influenza virus virions: determined by matrix M1 protein or host components? (Стендовый)
      • Авторы: Kordyukova L.V., Mintaev R.R., Abramchuk S.S., Serebryakova M.V., Markushin S.G.
      • 3rd International Symposium Membranes and Modules (September 05-08, 2018, Berlin, Germany), Свобоный Университет г. Берлин, Германия, 5-8 сентября 2018
      • 2018 Filamentous morphology of recombinant A/WSN/33 (h2N1) virions detected with novel electron microscopy protocols (Стендовый)
      • Авторы: Abramchuk S.S., Serebryakova M.V., Mintaev R.R., Markushin S.G., Kordyukova L.V.
      • 6th International Influenza meeting (02-04 September, 2018, Muenster, Germany), Мюнстер, Германия, 2-4 сентября 2018
      • 2011 Атомарный тритий в исследовании структурной организации надмолекулярных систем (Стендовый)
      • Авторы: Баратова Л.А., Добров Е.Н., Кордюкова Л.В., Лукашина Е.В., Федорова Н.В., Бадун Г.А., Богачева Е.Н., Шишков А.В., Ксенофонтов А.Л.
      • Российская Конференция «Радиохимия-наука настоящего и будущего», посвященная 100-летию со дня рождения Ан.Н. Несмеянова, Москва, Россия, 2011
      • 2009 Molecular Evolution of Influenza A Virus Hemagglutinin in consideration of Enzyme Proteolysis, Mass Spectrometry and Phylogeny Analysis Data. (Устный)
      • Авторы: Smirnova Yu A., Lebedev V.I., Semashko T.A., Kropotkina E.A., Kordyukova L.V., Serebryakova M.V.
      • Moscow Conference on Computational Molecular Biology, MCCMB’09, Москва, Россия, Россия, 2009
      • 2007 Influenza virus membrane proteome structural investigation based on enzyme proteolysis and MALDI-TOF mass spectrometry. (Стендовый)
      • Авторы: Smirnova Ju A., Kordyukova L.V., Veit М., Baratova L.A., Serebryakova M.V., Fedorova N.V.
      • Moscow Conference on Computational Molecular Biology, MCCMB’07, Москва, Россия, Россия, 2007
      • 2006 Influenza virus membrane proteins: studying by proteomic tools (Стендовый)
      • Авторы: Серебрякова М.В., Смирнова Ю.А., Тимофеева А.В., Markushin S.G., Баратова Л.А., Кордюкова Л.В., Федорова Н.В., Ivanova V.T.
      • 9th Chinese International Peptide Symposium (CPS-9), Shanghai, China, Китай, 2006
  • Тезисы докладов
      • 2018 Filamentous morphology of recombinant A/WSN/33 (h2N1) virions detected with novel electron microscopy protocols
      • Mintaev R.R., Abramchuk S.S., Serebryakova M.V., Markushin S.G., Kordyukova L.V.
      • в сборнике 6th International Influenza meeting (02-04 September, 2018, Muenster, Germany), место издания Muenster, Germany, тезисы, с. P15-P15
      • 2018 Homology-based modeling of the C-terminal inner region of pandemic h2N1 Influenza virus hemagglutinin
      • Khrustalev Vladislav Victorovich, Khrustaleva Tatyana Aleksandrovna, Kordyukova Larisa Valentinovna, Poboinev Victor Vitoldovich
      • в сборнике 6th International Influenza meeting (02-04 September, 2018, Muenster, Germany), место издания Muenster, Germany, тезисы, с. P48-P48
      • 2017 Lipidation of viral proteins studied with MALDI-TOF MS
      • Larisa Kordyukova, Marina Serebryakova, Michael Veit
      • в сборнике Proceedings Book of the 5th International Congress on Analytical Proteomics (ICAP 2017), 3rd-6th July, 2017, Lisbon, Portugal, место издания Proteomass, Caparica, Portugal, тезисы, с. 100-101
      • 2014 Assembly of Influenza virus particles: Signals for targeting of HA and M2 to the budding site
      • Veit M., Brett K., Kordyukova L., Serebryakova M., Siche S., Thaa B., Herrmann A.
      • в сборнике Abstracts of the 5th ESWI Influenza Conference, место издания Riga, Latvia, тезисы, с. 5
      • 2012 Palmitoylation of influenza virus proteins
      • Veit M., Kordyukova L.V., Serebryakova M.V., Engel S., Siche S., Brett K., Levental I., Herrmann A., Thaa B.
      • в сборнике Abstracts of A Biochemical Society Focused Meeting “Regulation of protein trafficking and function by palmitoylation” Oxford (UK), 23-25 August 2012, место издания Oxford (UK), тезисы, с. 4
      • 2011 Атомарный тритий в исследовании структурной организации надмолекулярных систем
      • Баратова Л.А., Добров Е.Н., Ксенофонтов А.Л., Кордюкова Л.В., Лукашина Е.В., Федорова Н.В., Бадун Г.А., Богачева Е.Н., Шишков А.В.
      • в сборнике Тезисы докл. Российской Конференции «Радиохимия-наука настоящего и будущего», посвященная 100-летию со дня рождения Ан.Н. Несмеянов, место издания Москва, тезисы, с. 28-29
      • 2005 Atomic tritium as an instrument for labeling and structural investigation of complex biological systems such as influenza virus particle
      • Ksenofontov A.L., Fedorova N.V., Lukashina E.V., Kordyukova L.V., Baratova L.A., Badun G.A., Shishkov A.V.
      • в сборнике Abstract Book 1st Int. Nuclear Chemistry Congress, место издания Kusadasi, Turkey, тезисы, с. 107-107
      • 2001 Studying the spatial organization of membrane proteins by means of tritium stratigraphy. Bacteriorhodopsin in purple membrane
      • Shishkov A.V., Ksenofontov A.L., Bogacheva E.N., Kordyukova L.V., Badun G.A., Alekseevsky A.V., Baratova L.A.
      • в сборнике XVIth International Symposium on Bioelectrochemistry and Bioenergetics, место издания Bratislava, Slovakia, тезисы, с. 80-80
  • НИРы
      • 1 января 2019 — 31 декабря 2022 Вирусный патогенез: роль вирусных и клеточных белков
      • Научно-исследовательский институт физико-химической биологии имени А.Н.Белозерского
      • Руководитель: Морозов С.Ю. Участники НИР: Андреева Н.В., Атабеков И.Г., Баратова Л.А., Гаврюшина Е.С., Галкина С.И., Гмырова Т.Н., Добров Е.Н., Дрыгин Ю.Ф., Жвачёв В.В., Калинина Н.О., Карлова Н.А., Клочков В.Н., Кордюкова Л.В., Ксенофонтов А.Л., Лезжов А.А., Лукашина Е.В., Махотенко А.В., Радюхин В.А., Соловьев А.Г., Тимофеева А.В., Федорова Н.В.
      • 1 января 2013 — 31 декабря 2018 Транспорт вирусов в растениях
      • Научно-исследовательский институт физико-химической биологии имени А.Н.Белозерского
      • Руководители: Атабеков И.Г., Морозов С.Ю. Участники НИР: Баратова Л.А., Гаврюшина Е.С., Галкина С.И., Гмырова Т.Н., Добров Е.Н., Дрыгин Ю.Ф., Жвачев В.В., Калинина Н.О., Карлова Н.А., Клочков В.Н., Кордюкова Л.В., Ксенофонтов А.Л., Лукашина Е.В., Макаров В.В., Минтаев Р.Р., Радюхин В.А., Скворцова И.Р., Соловьев А.Г., Тимофеева А.В., Федорова Н.В., Штыкова Э.В.
  • Членство в научных обществах
  • Участие в редколлегии журналов
  • Участие в программных комитетах конференций
  • Руководство диссертациями
  • Диссертация
  • Руководство дипломными работами
  • Авторство учебных курсов
      • 2009 Экспериментальные методы исследования белков и нуклеиновых кислот. Раздел I. Общий практикум.
      • Авторы: Баландина Г.Н., Филиппова И.Ю., Бачева А.В., Радюхин В.А., Галиуллина Р.А., Баратова Л.А., Федорова Н.В., Ташлицкий В.Н., Сергиев П.В., Кипарисов С.В., Громова Е.С., Кирсанова О.В., Субач О.М., Кордюкова Л.В., Серебрякова М.В., Королева О.Н., Друца В.Л.
  • Преподавание учебных курсов

Лариса Серебрякова, Омск, Россия — полная информация о человеке из профиля (id24372031) в социальных сетях (ВКонтакте)

Лариса Серебрякова

Информации о личной жизни Ларисы не найдено

Пользователь решил не оставлять личного статуса на своей страничке.

Фотографии

Просмотреть нельзя из-за настроек приватности профиля

Основная информация о Серебряковой Ларисе

  • Имя

    Лариса

  • Фамилия

    Серебрякова

  • Девичья фамилия

    Не указана

  • Пол

    Женщина

  • День рождения

    27

  • Месяц рождения

    сентябрь

  • Год рождения

    Скрыт

  • Дата рождения

    27.9

  • Полных лет

    Скрыто

  • Кто по гороскопу

    Весы

  • Страна

    Россия

  • Родной город

    Не указан

  • Город проживания

    Омск

  • Электронная почта (email)

    Скрыто

  • Номер телефона

    Известен, но скрыт

  • Владение языками

    Скрыто или не заполнено

Контакты, ссылки

  • Facebook

    Не указан

  • Twitter

    Не указан

  • Instagram

    Не указан

  • LiveJournal

    Не указан

  • Skype

    Не указан

  • VK ссылка

    id24372031

  • Личный сайт

    Не указан

Основная информация о её VK профиле

  • Галочка верификации

    Отсутствует

  • Дата регистрации профиля ВКонтакте

    05 декабря 2008 года

  • Прошло после регистрации

    12 лет 9 месяцев 21 день

  • Онлайн ли сейчас

    Нет

  • Когда была онлайн

    25 сентября 2021 в 08:15:19

  • С какого устройства заходила

    Через приложение для iPhone

  • ID профиля

    24372031

  • Никнейм (псевдоним)

    Короткий адрес страницы (домен, никнейм) не задан

Настройки приватности страницы Ларисы

Наполнение страницы

Где училась и работала

  • Школа

    Информация не указана или скрыта настройками приватности

  • ВУЗ

    Информация не указана или скрыта настройками приватности

  • Работа

    Информация не указана или скрыта настройками приватности

Хобби, интересы, увлечения

  • Деятельность

    Не указано или скрыто

  • Интересы

    Не указано или скрыто

  • Любимая музыка

    Не указано или скрыто

  • Любимые фильмы

    Не указано или скрыто

  • Любимые книги

    Не указано или скрыто

  • Любимые игры

    Не указано или скрыто

  • Любимые TV-шоу

    Скрыто или не указано

  • Любимые цитаты

    Не указано или скрыто

  • О себе

    Информация скрыта или не указана

Жизненная позиция

  • Главным в жизни считает

    Скрыто или не заполнено

  • Главным в людях считает

    Скрыто или не заполнено

  • Политические предпочтения

    Скрыто или не заполнено

  • Источники вдохновения

    Скрыто или не заполнено

  • Мировоззрение

    Скрыто или не заполнено

  • Как относится к алкоголю

    Скрыто или не заполнено

  • Как относится к курению

    Скрыто или не заполнено

Список друзей

К сожалению, не удаётся получить список друзей Ларисы.
Если статус профиля VK значится как «закрытый», это вполне нормально.
В противном случае попробуйте обновить данную страницу, иногда это помогает.

Удалить страницу

Если Вы являетесь владельцем этого vk профиля id24372031, можете легко его удалить с сайта profiles-vkontakte.ru, вся информация с этой страницы исчезнет, будто её тут и не было никогда. И гарантированно не появится тут снова.

Для удаления придётся кое-что сделать, чтобы алгоритм мог Вас идентифицировать, как владельца профиля. Ничего сложного и трудоёмкого: просто в качестве своего статуса ВКонтакте (именно на страничке где id 24372031) напишите pvkontakte123, без всяких пробелов и других символов, после чего нажмите кнопку «УДАЛИТЬ ПРОФИЛЬ».

Так система поймёт, что Вы — это действительно Вы, после чего произойдёт удаление, полностью в автоматическом режиме. Разумеется, после успешного удаления можно удалить статус pvkontakte123, поменять его, делать с ним всё что угодно — идентификация более не требуется.

А теперь ещё раз, коротко:

  1. Устанавливаете статус pvkontakte123
  2. Нажимаете кнопку УДАЛИТЬ ПРОФИЛЬ
  3. Вся публичная информация из vk о вас удаляется с profiles-vkontakte.ru навсегда.

Удалить профиль

Лариса Серебрякова

Личная информация

Деятельность

скрыта или не указана

Можно редактировать: да

Обязательно к заполнению: нет

Можно скрыть настройками приватности: да


Интересы

скрыты или не указаны

Можно редактировать: да

Обязательно к заполнению: нет

Можно скрыть настройками приватности: да


Любимая музыка

скрыта или не указана

Можно редактировать: да

Обязательно к заполнению: нет

Можно скрыть настройками приватности: да


Любимые фильмы

скрыты или не указаны

Можно редактировать: да

Обязательно к заполнению: нет

Можно скрыть настройками приватности: да


Любимые телешоу

скрыты или не указаны

Можно редактировать: да

Обязательно к заполнению: нет

Можно скрыть настройками приватности: да


Любимые книги

скрыты или не указаны

Можно редактировать: да

Обязательно к заполнению: нет

Можно скрыть настройками приватности: да


Любимые игры

скрыты или не указаны

Можно редактировать: да

Обязательно к заполнению: нет

Можно скрыть настройками приватности: да


Любимые цитаты

скрыты или не указаны

Можно редактировать: да

Обязательно к заполнению: нет

Можно скрыть настройками приватности: да


О себе

скрыто или не указано

Можно редактировать: да

Обязательно к заполнению: нет

Можно скрыть настройками приватности: да


Профессорско-преподавательский состав кафедры Экономики и экономической безопасности

​Хорошилова Ольга Владимировна

Должность: доцент

Ученая степень: кандидат экономических наук
Ученое звание: доцент

Дисциплины, закрепленные за преподавателем:

✔ Экономика фирмы

✔ Планирование на предприятии

✔ Планирование и прогнозирование

✔ Планирование и бюджетирование

Сысоев Александр Митрофанович

Должность: профессор

Ученая степень: доктор экономических наук
Ученое звание: доцент

Дисциплины, закрепленные за преподавателем:

✔ Макроэкономика

✔ Региональная экономика

​Серебрякова Надежда Александровна

Должность: профессор

Ученая степень: доктор экономических наук

Ученое звание: доцент

Дисциплины, закрепленные за преподавателем:​

✔ Микроэкономика

✔ Макроэкономика

✔ Макроэкономическое планирование и прогнозирование

✔ Экономическая теория

Богомолова Ирина Петровна


Должность: профессор
Ученая степень: доктор экономических наук
Ученое звание: профессор

Дисциплины, закрепленные за преподавателем:
✔ Финансовое планирование
✔ Финансовая безопасность
✔ Научно — исследовательская практика
✔ Научно — производственная практика
✔ Государственная итоговая аттестация


Боковая Нэлли Викторовна

Должность: доцент
Ученая степень: кандидат технических наук
Ученое звание: доцент

Дисциплины, закрепленные за преподавателем:

✔ Научно-исследовательская практика

✔ Научно-производственная практика

✔ Экономическая безопасность

✔ Государственная итоговая аттестация

 

Волкова Татьяна Александровна

Должность: доцент
Ученая степень: кандидат экономических наук
Ученое звание: доцент  

Дисциплины, закрепленные за преподавателем:

✔ Микроэкономика

✔ Экономическая безопасность предприятия

✔ Финансовые и предпринимательские риски

✔ Управление р​​исками в системе экономической безопасности​


Федосов Павел Егорович

Должность: доцент
Ученая степень: кандидат экономических наук
Ученое звание: доцент 

Дисциплины, закрепленные за преподавателем:

✔ Экономическая теория

✔ Экономическая теория (продвинутый уровень)

✔ Микроэкономика

✔ Макроэкономика​


 

Шарыкина Алла Леонидовна

Должность: доцент
Ученая степень: кандидат экономических наук
Ученое звание: доцент

Дисциплины, закрепленные за преподавателем:

✔ Контроллинг

✔ Научно-производственная практика

✔ Финансовое планирование

✔ Государственная итоговая аттестация


Кавыршина Ольга Александровна

Должность: доцент
Ученая степень: кандидат экономических наук
Ученое звание: доцент 

Дисциплины, закрепленные за преподавателем:

✔ Управление затратами предприятия (организации)

✔ Экономическая оценка стоимости предприятий (организаций)

✔ Теория и практика оценочной деятельности

✔ Теория и практика финансового оздоровления предприятия

✔ ​Оценка и управление стоимостью предприятия​

​Шенцева Лариса Николаевна

Должность: доцент

Ученая степень: кандидат географических наук​
Ученое звание: доцент

Дисциплины, закрепленные за преподавателем:
✔ Институциональная экономика
✔ Макроэкономическое планирование и прогнозирование
✔ Мировая экономика и международные экономические отношения
✔ Региональная экономика
✔ Размещение производительных сил​


Моисеева Владлена Михайловна

Должность: доцент​
Ученая степень: кандидат экономических наук

Дисциплины, закрепленные за преподавателем:

✔ Экономика предприятий и организаций

✔ Планирование на предприятии

✔ Планирование и прогнозирование в экономик

✔ Макроэкономическое планирование и прогнозирование

✔ Планирование и бюджетирование

✔ Экономика труда

✔ Управление затратам​

​​

Дедова Елена Сергеевна

Должность: доцент
Ученая степень: кандидат экономических наук

Дисциплины, закрепленные за преподавателем:

✔ Экономика предприятия

✔ Конкурентная разведка

✔ Преступления в сфере экономики

✔ Разработчик авторских курсов

✔ Управление фондовым портфелем

✔ Венчурное инвестирование​


Плужникова Наталья Викторовна

Должность: старший преподаватель
Квалификация: экономист

Дисциплины, закрепленные за преподавателем:

✔ Национальная экономика

✔ Региональная экономика

✔ Теоретические основы реструктуризации

✔ Экономика и организация деятельности торговых предприятий (организаций)

✔ Экономика недвижи​мости​

​Вязникова Ольга Евгеньевна

Должность: преподаватель
Ученая степень: кандидат экономических наук

Дисциплины, закрепленные за преподавателем:

✔ Внешнеэкономическая деятельность

✔ Внешнеэкономические операции

✔ Теневая экономика

✔ Экономика общественного сектора

✔ Экономическая безопасность

✅ ИП СЕРЕБРЯКОВА ЛАРИСА ЗАУРОВНА, 🏙 Кисловодск (OГРН 307262814200030, ИНН 262806464799) — 📄 реквизиты, 📞 контакты, ⭐ рейтинг

Последствия пандемии

В полной версии сервиса доступна вся информация по компаниям, которых коснулись последствия пандемии коронавируса: данные об ограничениях работы и о программе помощи от государства тем отраслям, которые испытывают падение спроса

Получить доступ

Краткая справка

ИП СЕРЕБРЯКОВА ЛАРИСА ЗАУРОВНА было зарегистрировано 22 мая 2007 (существовало 10 лет) под ИНН 262806464799 и ОГРНИП 307262814200030. Местонахождение Ставропольский край, город Кисловодск. Основной вид деятельности ИП СЕРЕБРЯКОВА ЛАРИСА ЗАУРОВНА: 82.99 Деятельность по предоставлению прочих вспомогательных услуг для бизнеса, не включенная в другие группировки. Телефон, адрес электронной почты, адрес официального сайта и другие контактные данные ИП СЕРЕБРЯКОВА ЛАРИСА ЗАУРОВНА отсутствуют в ЕГРИП. Ликвидировано 20 марта 2018.

Информация на сайте предоставлена из официальных открытых государственных источников.

Контакты ИП СЕРЕБРЯКОВА ЛАРИСА ЗАУРОВНА

Местонахождение

Россия, Ставропольский край, город Кисловодск

Зарегистрирован 22 мая 2007

Перейти ко всем адресам


Телефоны


Электронная почта


Пептиды галанина облегчают ишемию / реперфузию миокарда за счет уменьшения образования активных форм кислорода

  • Bergmeyer HU (1974) Методы ферментативного анализа. New York, Academic Press, стр. 1464–1467, 1772–1776, 1777–1781, 2127–2131

  • Бранчек Т.А., Смит К.Э., Джеральд С., Уокер М.В. (2000) Подтипы рецепторов галанина. Тенденции Pharmacol Sci 21: 109–117. https://doi.org/10.1016/S0165-6147(00)01446

    CAS Статья PubMed Google ученый

  • Бритиган Б.Э., Коэн М.С., Розен Г.М. (1987) Обнаружение производства кислород-центрированных свободных радикалов нейтрофилами человека с использованием методов спинового захвата: критическая перспектива.J Leukocyte Biol 41: 349–362. https://doi.org/10.1002/jlb.41.4.349

    CAS Статья PubMed Google ученый

  • Чен А., Ли М., Сонг Л. и др. (2015) Влияние антагониста рецептора галанина М40 на сердечную функцию и ремоделирование у крыс с сердечной недостаточностью. Cardiovasc Therapeut 33: 288–293. https://doi.org/10.1111/1755-5922.12144

    CAS Статья Google ученый

  • Fang P, He B, Yu M et al (2018) Центральный рецептор галанина 2 опосредует действие галанина, способствуя системному метаболизму глюкозы у крыс с диабетом 2 типа.Biochem Pharmacol 156: 241–247. https://doi.org/10.1016/j.bcp.2018.08.036

    CAS Статья PubMed Google ученый

  • Фердинанд П., Шульц Р. (2003) Оксид азота, супероксид и пероксинитрит при ишемии-реперфузии миокарда и прекондиционирование. Br J Pharmacol 138 (4): 532–543. https://doi.org/10.1038/sj.bjp.0705080

    CAS Статья PubMed PubMed Central Google ученый

  • Glanz SA (2021) Учебник по биостатистике, 7 изд.McGraw-Hill Companies Inc, Нью-Йорк

    Google ученый

  • He B, Shi M, Zhang L et al (2011) Благоприятное влияние галанина на чувствительность к инсулину в мышцах крыс с диабетом 2 типа. Physiol Behav 103 (3–4): 284–289. https://doi.org/10.1016/j.physbeh.2011.02.023

    CAS Статья PubMed Google ученый

  • Heusch G, Boengler K, Schulz R (2010) Ингибирование открытия пор перехода митохондриальной проницаемости: Святой Грааль кардиозащиты.Basic Res Cardiol 105: 151–154. https://doi.org/10.1007/s00395-009-0080-9

    Статья PubMed Google ученый

  • Heusch G (2020) Ишемия миокарда – реперфузионное повреждение и кардиопротекция в перспективе. Нат Рев Кардиол 17: 773–789. https://doi.org/10.1038/s41569-020-0403-y

    Статья PubMed Google ученый

  • Jakubczyk A, Karas M, Rybczynska-Tkaczyk K et al (2020) Современные тенденции биоактивных пептидов — новые источники и терапевтический эффект.Еда 9: 846. https://doi.org/10.3390/foods46

    CAS Статья PubMed Central Google ученый

  • Джей М.А., Рен Дж. (2007) Рецептор, активируемый пролифератором пероксисом (PPAR) при метаболическом синдроме и сахарном диабете 2 типа. Curr Diab Rev 3: 33–39. https://doi.org/10.2174/157339

  • 9802067

    CAS Статья Google ученый

  • Kim A, Park T (2010) Ожирение, вызванное диетой, регулирует галанин-опосредованный сигнальный каскад в жировой ткани мышей.Mol Nutr Food Res. 54: 1361–1370. https://doi.org/10.1002/mnfr.200

    7

    CAS Статья PubMed Google ученый

  • Krijnen PA, Nijmeijer R, Meijer CJ et al (2002) Апоптоз при ишемии и инфаркте миокарда. Дж. Клин Патол 55: 801–811. https://doi.org/10.1136/jcp.55.11.801

    CAS Статья PubMed PubMed Central Google ученый

  • Ланг Р., Гундлах А.Л., Холмс Ф.И. и др. (2015) Физиология, передача сигналов и фармакология пептидов и рецепторов галанина: три десятилетия появляющегося разнообразия.Pharmacol Rev 67: 118–175. https://doi.org/10.1124/pr.112.006536

    CAS Статья PubMed Google ученый

  • Легакис И.Н. (2005) Роль галанина в метаболических нарушениях, ведущих к сахарному диабету 2 типа. Новости наркотиков Persp 18 (3): 173–177. https://doi.org/10.1358/dnp.2005.18.3.892762

    CAS Статья Google ученый

  • Miinea CP, Sano H, Kane S. et al (2005) AS160, субстрат Akt, регулирующий транслокацию GLUT4, имеет функциональный домен белка Rab GTPase.Biochem J 391: 87–93. https://doi.org/10.1042/BJ20050887

    CAS Статья PubMed PubMed Central Google ученый

  • Murphy E, Steenbergen C (2008) Механизмы, лежащие в основе острой защиты от сердечного ишемического реперфузионного повреждения. Physiol Rev 88: 581–609. https://doi.org/10.1152/physrev.00024.2007

    CAS Статья PubMed Google ученый

  • Палькеева М., Студнева И., Молокоедов А. и др. (2019) Система Галанин / GalR1-3: перспективная терапевтическая мишень при ишемии / реперфузии миокарда.Biomed Pharmacother 109: 1556–1562. https://doi.org/10.1016/j.biopha.2018.09.182

    CAS Статья Google ученый

  • Писаренко О., Тимотин А., Сидорова М. и др. (2017) Кардиозащитные свойства N-концевого фрагмента галанина (2–15) при экспериментальном ишемическом / реперфузионном повреждении. Oncotarget 8: 101659–101671. https://doi.org/10.18632/oncotarget.21503

    Статья PubMed PubMed Central Google ученый

  • Писаренко О., Студнева И., Серебрякова Л. и др. (2021) Антиоксидантные свойства галанина и его N-концевых фрагментов при моделировании in vitro и in vivo окислительного стресса.Биохимия (Москва) 86 (4): 496–505. https://doi.org/10.1134/S0006297

  • 0106

    CAS Статья Google ученый

  • Power O, Jakeman P, FitzGerald RJ (2013) Антиоксидантные пептиды: ферментативное производство, антиоксидантная активность in vitro и in vivo и потенциальные применения антиоксидантных пептидов, полученных из молока. Аминокислоты 44: 797-820. https://doi.org/10.1007/s00726-012-1393-9

    CAS Статья PubMed Google ученый

  • Raedschelders K, Ansley DM, Chen DD (2012) Клеточное и молекулярное происхождение генерации активных форм кислорода во время ишемии и реперфузии миокарда.Pharmacol Ther 133: 230–255. https://doi.org/10.1016/j.pharmthera.2011.11.004

    CAS Статья PubMed Google ученый

  • Серебрякова Л., Палькеева М., Студнева И. и др. (2019) Галанин и его N-концевые фрагменты уменьшают острый инфаркт миокарда у крыс. Пептиды 111: 127–131. https://doi.org/10.1016/j.peptides.2018.05.001

    CAS Статья PubMed Google ученый

  • Сидорова М.В., Палкеева М.Е., Авдеев Д.В. и др. (2020) Конвергентный синтез галанина крысы и изучение его биологической активности.Русс Дж. Биоорг. Хим. 46 (1): 32–42. https://doi.org/10.1134/S1068162020010100

    CAS Статья Google ученый

  • Студнева И.М., Веселова О.М., Бахтин А.А. и др. (2020) Механизмы защиты сердца с использованием синтетического агониста рецепторов галанина при хроническом применении доксорубицина. Acta Naturae 12 (1): 20–29. https://doi.org/10.32607/20758251-2020-12-1-89-98

    Статья Google ученый

  • Государственная фармакопея РФ XIII издание, GPM1.2.1.0005.15 Растворимость, Москва, 2015. https://pharmacopoeia.ru/gosudarstvennaya-farmakopeya-xiii-online-gf-13-online

  • Тимошин А.А., Цкитишвили О.В., Серебрякова Л.И. и др. (1994) Микродиализ исследование гидроксильных радикалов в сердце собаки, вызванных ишемией. Experientia 50: 677–679

    CAS Статья Google ученый

  • Тимошин А.А., Дроботова Д.Ю., Цкитишвили О.В. и др. (2010) Защитный эффект комплексов динитрозил-железо с глутатионом при регионарной ишемии миокарда крыс: исследование с помощью микродиализного анализа.Докл Биохим Биофиз 432: 106–109. https://doi.org/10.1134/s16076720038

    CAS Статья PubMed Google ученый

  • Тимотин А., Чинато М., Крамар С. и др. (2019) Галанин — это контрольный регулятор митохондриального биогенеза, координирующий фенотип, способствующий выживанию, при постинфарктном ремоделировании миокарда, препринт на https://papers.ssrn.com/ sol3 / paper.cfm? abstract_id = 3424189

  • Тимотин А., Писаренко О., Сидорова М. и др. (2017) Защита миокарда от ишемии / реперфузионного повреждения экзогенным фрагментом галанина.Oncotarget 8: 21241–21252. https://doi.org/10.18632/oncotarget.15071

    Статья PubMed PubMed Central Google ученый

  • Venardos KM, Perkins A, Headrick J, Kaye DM (2007) Ишемия-реперфузионное повреждение миокарда, системы антиоксидантных ферментов и селен: обзор. Curr Med Chem 14: 1539–1549. https://doi.org/10.2174/092986707780831078

    CAS Статья PubMed Google ученый

  • Webling KEB, Runesson J, Bartfai T, Langel Ü (2012) Рецепторы и лиганды галанина.Передний эндокринол 3: 146. https://doi.org/10.3389/fendo.2012.00146

    Статья Google ученый

  • YtrehusK LY, Tsuchida A et al (1994) Инфаркт сердца крысы и кролика: эффекты анестезии, перфузата, зона риска и метод определения размера инфаркта. Am J Physiol 267: h3383 – h3390. https://doi.org/10.1152/ajpheart.1994.267.6.h3383

    Статья Google ученый

  • Галанин и его N-концевые фрагменты уменьшают острый инфаркт миокарда у крыс

    DOI: 10.1016 / j.peptides.2018.05.001. Epub 2018 3 мая.

    Принадлежности Расширять

    Принадлежности

    • 1 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 2 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 3 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 4 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 5 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 6 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 7 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 8 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 9 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]

    Элемент в буфере обмена

    Лариса Серебрякова и соавт.Пептиды. 2019 Янв.

    Показать детали Показать варианты

    Показать варианты

    Формат АннотацияPubMedPMID

    DOI: 10.1016 / j.peptides.2018.05.001. Epub 2018 3 мая.

    Принадлежности

    • 1 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: serebrolar09 @ яндекс.RU.
    • 2 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 3 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 4 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 5 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 6 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 7 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 8 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]
    • 9 Национальный медицинский исследовательский центр кардиологии, 121552, г. Москва, 3-я Черепковская ул., 15А, Российская Федерация. Электронный адрес: [email protected]

    Элемент в буфере обмена

    Полнотекстовые ссылки Опции CiteDisplay

    Показать варианты

    Формат АннотацияPubMedPMID

    Абстрактный

    Агонисты и антагонисты подтипов рецепторов галанина GalR1-3 могут быть использованы в качестве предполагаемых терапевтических мишеней для лечения различных заболеваний человека.Однако влияние галанина и его N-концевых фрагментов на ишемию / реперфузионное повреждение миокарда остается неясным. Это исследование было разработано для оценки способности полноразмерного галанина (GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-Nh3, G1), природных фрагментов WTLNSAGYLL-Nh3 (G2) и WTLNSAGYLLGPHA (G3) и их модифицированных аналогов GTLNAGYLL (G3) и их модифицированных аналогов GTLNAGYLL (WTLNAGYLL) для ограничения острого инфаркта миокарда у крыс in vivo. Пептиды G2-5 были синтезированы автоматическим твердофазным методом с использованием технологии Fmoc, очищены препаративной ВЭЖХ и идентифицированы с помощью спектроскопии ЯМР 1Н и масс-спектрометрии MALDI-TOF.Пептиды G1-5 вводили внутривенно. болюсная инъекция в начале реперфузии в дозах 0,25, 0,50, 1,0, 2,0 или 3,0 мг / кг. Оптимальные дозы пептидов G1-5 значительно снижали площадь инфаркта и снижали активность CK-MB и LDH в плазме крови в конце реперфузии по сравнению с контролем. Среди изученных пептидов G5 показал высокую эффективность в уменьшении размера инфаркта и активности маркеров некроза в плазме крови без значительного влияния на гемодинамические параметры.Результаты показывают, что новый агонист рецепторов галанина G5 может быть многообещающим инструментом для лечения ишемии / реперфузии миокарда (I / R). Необходимы дальнейшие исследования для изучения стабильности этого пептида в плазме крови и механизмов, которые способствуют его кардиозащитному действию.

    Ключевые слова: Галанин; Гемодинамические параметры; Модифицированные фрагменты галанина; Инфаркт миокарда; Маркеры некроза; Крыса.

    Авторские права © 2018 Elsevier Inc. Все права защищены.

    Похожие статьи

    • Система Галанин / GalR1-3: многообещающая терапевтическая мишень при ишемии / реперфузии миокарда.

      Палкеева М., Студнева И., Молокоедов А., Серебрякова Л., Веселова О., Овчинников М., Сидорова М., Писаренко О. Палкеева М. и др.Biomed Pharmacother. 2019 Янв; 109: 1556-1562. DOI: 10.1016 / j.biopha.2018.09.182. Epub 2018 14 ноя. Biomed Pharmacother. 2019. PMID: 30551408

    • Активация рецепторов галанина модулирует метаболические и антиоксидантные реакции миокарда на ишемию / реперфузионный стресс.

      Студнева И., Серебрякова Л., Веселова О., Палькеева М., Молокоедов А., Овчинников М., Коновалова Г., Ланкин В., Сидорова М., Писаренко О.Студнева И. и др. Clin Exp Pharmacol Physiol. 2019 декабрь; 46 (12): 1174-1182. DOI: 10.1111 / 1440-1681.13164. Epub 2019 17 сентября. Clin Exp Pharmacol Physiol. 2019. PMID: 31429479

    • Антиоксидантные свойства галанина и его N-концевых фрагментов in vitro и in vivo моделирование окислительного стресса.

      Писаренко О.И., Студнева И.М., Серебрякова Л.И., Тимошин А.А., Коновалова Г.Г., Ланкин В.З., Тихазе А.К., Веселова О.М., Доброхотов И.В., Любимов Р.О., Сидорова М.В., Палькеева М.Е., Молокоедов А.С.Писаренко О.И. и др. Биохимия (Москва). 2021 Апрель; 86 (4): 496-505. DOI: 10,1134 / S0006297

    • 0106. Биохимия (Москва). 2021 г. PMID: 33941070

    • [Кардиометаболическая эффективность и токсикологическая оценка фармакологического агониста рецептора галанина].

      Серебрякова Л.И., Студнева И.М., Овчинников М.В., Веселова О.М., Молокоедов А.С., Арзамасцев Е.В., Афанасьева Е.Ю., Терехова О.А., Сидорова М.В., Писаренко О.И.Серебрякова Л.И., и др. Биомед Хим. 2019 Апрель; 65 (3): 231-238. DOI: 10.18097 / PBMC20196503231. Биомед Хим. 2019. PMID: 31258147 Русский.

    • Антагонисты рецепторов галанина: потенциальное новое фармакологическое лечение расстройств настроения.

      Огрен С.О., Кутеева Э., Хёкфельт Т., Кехр Дж. Огрен С.О. и др. Препараты ЦНС. 2006; 20 (8): 633-54. DOI: 10.2165 / 00023210-200620080-00003.Препараты ЦНС. 2006 г. PMID: 16863269 Рассмотрение.

    Типы публикаций

    • Поддержка исследований, за пределами США. Правительство

    Условия MeSH

    • Галанин / аналоги и производные *
    • Галанин / терапевтическое применение *
    • Инфаркт миокарда / кровь
    • Инфаркт миокарда / медикаментозная терапия *
    • Инфаркт миокарда / метаболизм
    • Пептиды / терапевтическое использование *
    • Рецепторы, Галанин / кровь
    • Рецепторы, Галанин / метаболизм

    LinkOut — дополнительные ресурсы

    • Полнотекстовые источники

    • Другие источники литературы

    • Медицинские

    • Материалы для исследований

    • Разное

    [Икс]

    цитировать

    Копировать

    Формат: AMA APA ГНД NLM

    Абстрактные

    Абстрактные

    Антиоксидантные свойства галанина и его N-концевых фрагментов в

    в vitro и in vivo Моделирование окислительного стресса
    Олег И.Писаренко
    1, а * , Ирина Михайловна Студнева 1 , Серебрякова Лариса Ивановна 1 , Александр А. Тимошин 1 , Коновалова Галина Григорьевна 1 , Вадим З. Ланкина 1 , Тихазе Алла Константиновна 1 , Оксана М. Веселова 1 , Доброхотов Игорь Викторович 1 , Роман О. Любимов 1 , Сидорова Мария Викторовна 1 , Марина Е. Палкеева 1 , Молокоедов Александр Сергеевич 1 1 Национальный медицинский исследовательский центр кардиологии Министерства Российской Федерации Здравоохранение Российской Федерации, 121552 Москва, Россия

    * Кому следует адресовать корреспонденцию.

    Поступило 21.12.2020 г .; Редакция от 4 февраля 2021 г .; Принято в феврале 8, 2021
    Антиоксидантные свойства галанина крысы GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH 2 (Gal), N-концевой фрагмент галанина (2-15 а.о.) WTLNSAGYLLGPHA (G1) и его модифицированного аналога WTLNSAGYLLGPβAH (G2) были изучены in vivo на модели крысы регионарной ишемии и реперфузии миокарда и in vitro при процесс свободнорадикального окисления человека, индуцированного Cu 2+ . липопротеиды низкой плотности плазмы крови.Внутривенное введение G1, G2 и Gal крысам после индукции ишемии уменьшили инфаркт размер и активность маркеров некроза, креатинкиназы-MB и лактатдегидрогеназа в плазме крови в конце реперфузии. G1, G2 и Gal снижают образование спиновых аддуктов гидроксильных радикалов. в интерстиции зоны риска во время реперфузии, кроме того, G2 и Gal также снижают образование вторичных продуктов липидного обмена. перекисное окисление в реперфузированном миокарде. Был показан в в г. vivo и в модельной системе in vitro , что способность пептидов галанина снижать образование АФК и ослаблять перекисного окисления липидов при реперфузионном повреждении миокарда не наблюдалось. напрямую связаны с их влиянием на активность антиоксиданта ферменты сердца: Cu, Zn-супероксиддисмутаза, каталаза и глутатионпероксидаза.Пептиды G1, G2 и Gal в концентрациях 0,01 и 0,1 мМ ингибирует свободный радикал, индуцированный Cu 2+ окисление липопротеинов низкой плотности человека in vitro . В результаты моделирования окислительного стресса показали, что естественный и синтетические агонисты рецепторов галанина снижают образование короткоживущие АФК в реперфузированном миокарде, а также липидные радикалы в плазме крови. Таким образом, рецепторы галанина могут быть многообещающим терапевтическая мишень при сердечно-сосудистых заболеваниях.
    КЛЮЧЕВЫЕ СЛОВА : галанин, сердце, ишемия и реперфузия, некроз, перекисное окисление липидов, антиоксидантные ферменты, повреждение мембран кардиомиоцитов

    DOI : 10.1134 / S00062970106



    Стеариновая кислота подавляет передачу сигналов фактора роста посредством олеоилирования белков GNAI

    Клеточная культура и лечение

    Клетки MCF7, приобретенные в ATCC (ATCC HTB-22), культивировали в среде DMEM с высоким содержанием глюкозы (Gibco) с добавлением 10% FCS ( Sigma-Aldrich), 1% заменимых аминокислот (Gibco), 100 Ед / мл пенициллина и 100 мкг / мл стрептомицина (Gibco) в инкубаторе 37 ° C в стабильной атмосфере 5% CO 2 .Для трансфекции siRNA реагент для трансфекции Lipofectamine RNAiMAX (Thermo Scientific) смешивали в соответствии с инструкциями производителя с siRNA (Dharmacon; Дополнительные данные 1) в среде с пониженным содержанием сыворотки Opti-MEM (Gibco), и клетки использовали в эксперименте через 48 часов. Для трансфекции плазмид реагент для трансфекции липофектамина 2000 (Thermo Scientific) использовали за 24 часа до эксперимента. Отдельные клоны, стабильно экспрессирующие белок из векторов на основе pcDNA3, выделяли и поддерживали после добавления генетицина (0.5 мг / мл, Gibco). В экспериментах, где временная трансфекция сочеталась с обработкой жирными кислотами, Lipofectamine RNAiMAX и 2000 были заменены реагентами для безлипидной трансфекции Viromer Blue и Red (Lipocalyx), соответственно. Для использования в культуре клеток жирные кислоты и их производные конъюгировали с BSA 14 . Вкратце, жирные кислоты растворяли до концентрации 50 мМ в 100 мМ NaOH при 95 ° C. После растворения 100 мкл жирной кислоты по каплям добавляли к 600 мкл 10% -ного БСА, не содержащего жирных кислот, предварительно нагретого до 50 ° C.После перемешивания объем был заполнен водой до 1 мл для достижения конечной концентрации жирной кислоты 5 мМ. Конъюгированные с БСА жирные кислоты наносили на клетки до конечной концентрации 100 мкМ. Исходные и производные линии клеток были отрицательными на контаминацию микоплазмой (Eurofins Genomics, Германия). Клеточные линии были аутентифицированы с использованием мультиплексной клеточной аутентификации посредством мультиплексирования (Гейдельберг, Германия), как недавно описано 73 .

    Клонирование и сайт-направленный мутагенез GNAI1 / 2/3 и ZDHHC7

    Последовательности праймеров, используемых в этом исследовании, представлены в дополнительных данных 2.Открытые рамки считывания человеческих GNAI1 , GNAI2 , GNAI3 и ZDHHC7 были амплифицированы с помощью ПЦР из кДНК клеток MCF7 с праймерами, содержащими EcoRI и High BamHI (GNAI1-3) или NotI (ZDHHusion), с использованием сайтов -Полимераза Fidelity (Thermo Scientific) и клонированная в каркас pcDNA3, содержащий C-концевую ( GNAI1-3 ) или N-концевую ( ZDHHC7 ) V5-метку. Из-за наличия внутреннего сайта рестрикции BamHI в последовательности GNAI2 в этом случае бактериальные клоны с правильной конструкцией были предварительно отобраны с помощью ПЦР колоний.Для мутации N-концов GNAI1 / 2/3 использовали праймеры с желаемой мутацией для ПЦР-амплификации GNAI1 / 2/3 из pcDNA3- GNAI1 / 2/3-V5 , и амплифицированные мутировавшие вставки были клонирован в тот же самый остов pcDNA3, содержащий C-концевой V5-тег. Для GNAI1 и GNAI3 снова использовали сайты рестрикции EcoRI и BamHI, которые покрывают всю открытую рамку считывания. В случае GNAI2 сайты рестрикции EcoRI и NheI использовали для вставки мутированной N-концевой части GNAI2 в pcDNA3- GNAI2-V5 .Вставки GNAI3, дикого типа и мутантные вставки амплифицировали с помощью ПЦР из плазмид pcDNA3- GNAI3-V5 с использованием праймеров с сайтами рестрикции EcoRI и BamHI и субклонировали в основную цепь pcDNA3, содержащую C-концевую GFP-метку. Для мутации активного сайта ZDHHC7 использовали праймеры с желаемой мутацией (C160A) для ПЦР-амплификации всей плазмиды, содержащей V5-ZDHHC7 . Последовательность всех конструкций подтверждали секвенированием. Олиго были разработаны с использованием Primer-BLAST (https: // www.ncbi.nlm.nih.gov/tools/primer-blast), а манипуляции с последовательностями выполняли с использованием программного обеспечения A Plasmid Editor (ApE).

    Генерация клеток GNAI3 KO с использованием технологии CRISPR

    Инструмент разработки CRISPR (http://crispr.mit.edu) был использован для создания sgRNAs, нацеленных на первый экзон человеческого GNAI3 74 . Специфичность созданных sgRNA была проверена с помощью Cas-OFFinder с помощью CRISPR RGEN Tools (http://www.rgenome.net/cas-offinder/) 75 . Олигонуклеотиды были синтезированы и субклонированы в вектор PX459 с использованием сайтов рестрикции BbsI.Последовательности конечных плазмид проверяли секвенированием с использованием 5′-праймера LKO.1. Для трансфекции плазмид в клетки MCF7 использовали липофектамин 2000 (Thermo Fisher) в соответствии с инструкциями производителя. После разведения отдельных клеток отдельные отдельные клоны подвергали скринингу с помощью иммуноблоттинга на отсутствие белка GNAI3. Геномную ДНК выделяли из предполагаемых клонов с нокаутом, и область, на которую нацелена sgRNA, амплифицировали с помощью ПЦР. Используя набор для клонирования TOPO TA (Thermo Fisher), продукты ПЦР вставляли в вектор pCRII-TOPO и секвенировали с помощью прямого праймера M13 в количестве, достаточном для оценки генотипа всех трех аллелей GNAI3.В выбранном клоне были обнаружены три разные мутации со сдвигом рамки считывания, приводящие к раннему стоп-кодону.

    Белковый электрофорез и вестерн-блоттинг

    Клетки лизировали в буфере RIPA (150 мМ NaCl, 1% (об. / Об.) Nonidet P-40, 1% (мас. / Об.) Дезоксихолат натрия, 0,1% SDS, 50 мМ Tris- Cl pH 8,0) с добавлением коктейля ингибиторов протеазы (Roche) и 100 Ед / мл бензоназы (Merck), а также, если необходимо выявить фосфорилированные белки, также коктейлем ингибиторов фосфатазы PhosSTOP (Roche), 100 мМ фторида натрия, 2 мМ ортованадат натрия и 64 мМ бета-глицерофосфат.Концентрации белка определяли с помощью анализа BCA (набор Pierce BCA Protein Assay Kit, Thermo Fisher Scientific) с использованием BSA в качестве стандарта. Лизаты денатурировали инкубацией с буфером для образцов Лэммли в течение 5 минут при 95 ° C и разделяли с помощью трис-глицинового SDS-PAGE. Белки переносили на нитроцеллюлозную мембрану и детектировали первичными антителами в соответствии с инструкциями производителей с последующей инкубацией с конъюгированными с HRP вторичными антителами, разведенными 1: 10 000. Хемилюминесценцию регистрировали с помощью Chemidoc Imager (Bio-Rad) и количественно оценивали с помощью программного обеспечения Image Lab (Bio-Rad).

    Кроличьи анти-AKT (№ 9272, 1: 1000), кроличьи моноклональные анти-кавеолин-1 (№ 3267, 1: 1000), кроличьи моноклональные анти-CD71 (рецептор трансферрина 1; № 13113, 1: 1000), кролик моноклональные анти-c-Myc / N-Myc (# 13987, 1: 1000), кроличьи моноклональные анти-EGFR (# 4267, 1: 1000), кроличьи моноклональные анти-флотилин-1 (# 18634, 1: 1000), кролик анти-Gab1 (# 3232, 1: 1000), кроличьи моноклональные анти-GAPDH (# 2118, 1: 1000), мышиные моноклональные анти-p44 / p42 MAPK (Erk1 / 2; # 9107, 1: 1000), кроличьи моноклональные антитела -пан-кадгерин (# 9107, 1: 1000), кроличий антифосфо-AKT (Ser473; # 9271, 1: 1000), кроличий моноклональный антифосфо-AKT (Thr308; # 2965, 1: 1000), кроличий моноклональный Антитела против фосфо-p44 / p42 MAPK (Thr202 / Tyr204; # 4370, 1: 1000) были приобретены в Cell Signaling Technology.Кроличьи моноклональные анти-GNA1 (# ab140125, 1: 1000), кроличьи моноклональные анти-GNAI2 (# ab137050, 1: 1000), кроличьи моноклональные анти-GNAI3 (# ab173527, 1: 1000) и мышиные моноклональные анти-PDI (# 1, 1: 1000) антитела были приобретены у Abcam. Мышиные моноклональные антитела против GM130 (# 610823, 1: 1000) получали от BD Biosciences, мышиные моноклональные антитела против V5 (# R960-25, 1: 1000) от Thermo Fisher и мышиные моноклональные антитела против α-тубулина (# T9026, 1: 3000) от Sigma-Aldrich.

    Анализ обмена ацил-ПЭГ

    Для обнаружения S-ацилирования был проведен анализ обмена ацил-ПЭГ, метод, основанный на селективном мечении малеимидом ацилированных цистеинов, вызывающих сдвиг массы, как описано ранее 46,76 , с использованием метоксиполиэтиленгликоль малеимид (мПЭГ, 5 кДа).

    Обнаружение липидных модификаций на основе щелочной химии

    Белки, модифицированные C15: 0- и C17: 0-азидом, удаляли с помощью набора Click Chemistry Capture Kit (Jena Bioscience) и шариков алкин-агарозы (Jena Bioscience). Клетки высевали в 10-сантиметровые чашки для культивирования. Для рис. 1d при достижении 80% слияния клетки инкубировали с DMEM с добавлением делипидированного FBS 14 в течение 24 часов, чтобы лишить их жирных кислот. Во всех других экспериментах, которые проводились впоследствии, этот этап голодания был пропущен, поскольку в нем нет необходимости.После этого клетки инкубировали в течение 3 ч со 100 мкМ аналогами жирных кислот, конъюгированными с BSA. Были использованы следующие азиды жирных кислот: C15: 0-азид (15-азидопентадекановая кислота) от Life Technologies и C17: 0-азид (17-азидогептадекановая кислота) из исх. 14 . Обработка BSA использовалась в качестве отрицательного контроля. После обработки клетки кратковременно промывали PBS, уравновешенным до комнатной температуры, и лизировали в 1 мл лизисного буфера на основе мочевины с добавлением коктейля ингибиторов протеаз (Roche).Лизаты переносили в пробирки, обрабатывали ультразвуком на льду в течение 30 с (амплитуда 10%) и очищали центрифугированием при 20,800 × g в течение 5 минут при 4 ° C. Щелкающие реакции были собраны в соответствии с протоколом, предоставленным производителем, то есть 800 мкл лизата смешивали с 200 мкл гранул алкин агарозы и 1 мл реакционной смеси. Образцы вращали встык в течение 16–20 ч при комнатной температуре. Гранулы агарозы промывали H 2 O, осаждали при 1000 × г в течение 1 мин и переносили в колонки для интенсивной промывки буфером для промывки агарозы.Промытые шарики ресуспендировали в H 2 O и снова переносили в пробирки. Гранулы осаждали при 1000 × г в течение 1 мин и ресуспендировали в 2 × буфере для образцов Лэммли с добавлением 1 М гидроксиламина для элюирования связанных белков. Образцы инкубировали 15 мин при комнатной температуре, а затем кипятили при 95 ° C в течение 5 мин. Гранулы осаждали при 1000 × г и элюат переносили в новые пробирки. Вытянутые белки загружали в гель вместе с клеточными лизатами, которые сохраняли в качестве входных данных.Вестерн-блоты зондировали антителами для проверки наличия специфических белков в выпадающих списках.

    Обнаружение модификаций липидов масс-спектрометрией MALDI-TOF

    Природу жирного ацильного остатка на очищенном GNAI3 анализировали с помощью МС. Для очистки больших количеств GNAI3 мы использовали GFP-связывающий белок (GBP) 77 , который может сбрасывать GNAI3-GFP с высокой аффинностью и селективностью. Вкратце, GBP был экспрессирован в компетентных бактериях BL21 (Rosetta) из плазмиды pET28c, несущей 6xHis-GBP, очищен с использованием гранул агарозы Ni-NTA, подвергнут диализу и ковалентно связан с активированными гранулами сефарозы в соответствии с инструкциями производителя.Клетки MCF7 со стабильной экспрессией GNAI3-GFP собирали трипсинизацией и лизировали в буфере для лизиса (20 мМ Tris-Cl, 800 мМ NaCl, 0,5 мМ EDTA, 1% NP-40, pH 7,5) с добавлением коктейля ингибиторов протеаз (Roche ) и пальостатин B, ингибитор деацилазы, для достижения конечной концентрации 250 мкМ (EMD Millipore Calbiochem InSolution APT1 ингибитор пальостатин B). Очищенные лизаты разбавляли 1: 2 буфером для разведения (20 мМ Трис-Cl, 150 мМ NaCl, 0,5 мМ ЭДТА, pH 7,5) и смешивали с гранулами GBP-сефарозы.Очистку проводили в течение 2 ч при 4 ° C с непрерывным вращением. Гранулы сефарозы промывали 4 раза промывочным буфером (20 мМ Tris-Cl, 300 мМ NaCl, 0,5 мМ EDTA, pH 7,5) и очищенные белки элюировали невосстанавливающим буфером Лэммли в течение 5 минут при 95 ° C. Элюированные белки алкилировали 30 мМ йодацетамида (IAA) в течение 30 минут в темноте, разделяли с помощью SDS-PAGE и переносили на PVDF-мембрану с последующим окрашиванием Ponceau S. Полоса, соответствующая GNAI3-GFP, обрабатывалась, как описано ниже (аналогично исх. 78 с небольшими изменениями): его разрезали на мелкие кусочки, быстро промывали 100-200 мкл 40% ацетонитрила / 50 мМ NH 4 HCO 3 (pH 7,5) и переваривали 10 мкл трипсина ( Promega, 15 мкг / мкл в 80% ацетонитриле / 20 мМ NH 4 HCO 3 , pH 7,5) в течение 1 ч при 37 ° C. Раствор вода-ацетонитрил, содержащий гидрофильные и слегка гидрофобные пептиды, переносили в чистую пробирку и отбирали аликвоту (1-2 мкл) для подтверждения идентичности белка с помощью анализа MALDI-TOF MS и следования серверу Mascot (www.matrixscience.com) поиск. Основную часть замораживали до объединения с органическими элюатами и до дальнейшего анализа. Для высвобождения сильно гидрофобных пептидов части мембраны дополнительно покрывали смесью 5–10 мкл гексафторизопропанола (HFIP) и 10 мкл хлороформа в течение от 2 часов до ночи. Экстракты вода-ацетонитрил и HFIP / хлороформ объединяли, добавляли 15-20 мкл 0,5% раствора трифторуксусной кислоты / воды для разделения фаз и удаления избытка буферных солей, и органическую фазу, обогащенную различными гидрофобными пептидами, собирали для MALDI. -TOF MS анализ.Аликвоты образцов (1 мкл) смешивали на стальной мишени с равным объемом 2,5-дигидроксибензойной кислоты в 30% водном растворе ацетонитрила / 0,5% трифторуксусной кислоты (10 мг / мл). Масс-спектры записывали на масс-спектрометре Ultraflextreme MALDI TOF-TOF (Bruker Daltonik, Германия), оборудованном лазером 355 нм (Nd). Молекулярные ионы MH + были измерены в режиме отражателя для определения масс моноизотопных пиков с точностью до 30 ppm. Спектры фрагментации получали в режиме LIFT, точность измерения дочерних ионов не превышала 1 Да.Масс-спектры обрабатывали с помощью программы FlexAnalysis 3.2 (Bruker Daltonik, Германия) и анализировали вручную.

    Совместная очистка аффинной GFP

    Для обнаружения белков, взаимодействующих с EGFR-GFP, была использована аффинная очистка GFP с использованием GFP-связывающего белка (GBP), связанного с шариками сефарозы, на основании ссылки. 77 . Протокол был изменен по сравнению с очисткой GNAI3-GFP для анализа MS (см. Выше). MCF7 дикого типа или GNAI3 KO временно трансфицировали плазмидой, несущей конструкцию EGFR-GFP или GFP только в качестве контроля, с использованием Viromer Red в соответствии с инструкциями производителя.На следующий день клетки обрабатывали конъюгированным с BSA C18: 0 или C18: 1 (100 мкМ, в течение 3 или 24 часов, как указано). После этого культуральную среду заменяли на PBS, и клетки обрабатывали 50 нг / мл EGF в течение 5 минут при комнатной температуре. Затем добавляли дитиобис (сукцинимидилпропионат) (DSP), сшивающий агент, для достижения конечной концентрации 0,5 мМ. После 30 мин инкубации при комнатной температуре реакцию сшивания гасили 20 мМ трис-Cl pH 7,5 в течение 15 мин. Клетки дважды промывали PBS и лизировали ледяным буфером для лизиса (20 мМ Tris-Cl, 800 мМ NaCl, 0.5 мМ ЭДТА, 1% NP-40, pH 7,5) с добавлением коктейля ингибиторов протеаз (Roche). Очищенные лизаты доводили с помощью буфера для разведения (20 мМ Tris-Cl, 150 мМ NaCl, 0,5 мМ EDTA, pH 7,5) до той же концентрации и смешивали с гранулами GBP-сефарозы. Очистку проводили в течение ночи при 4 ° C с непрерывным вращением. Затем шарики промывали пять раз промывочным буфером (20 мМ Трис-Cl, 300 мМ NaCl, 0,5 мМ ЭДТА, 0,1% NP-40, pH 7,5) и очищенные белки элюировали 2-кратным буфером Лэммли в течение 5 мин при 95 °. С.Наличие интересующих белков проверяли с помощью иммуноблоттинга.

    Иммунофлуоресценция

    Клетки высевали на покровные стекла в 24-луночные планшеты (50 000–80 000 клеток на лунку) и трансфицировали или непосредственно обрабатывали на следующий день. Вкратце, клетки фиксировали 4% параформальдегидом в PBS в течение 20 минут, трижды промывали ледяным PBS, пропитывали PBS + 0,2% (об. / Об.) Triton X-100 в течение 10 минут и снова трижды промывали PBS. . После блокирования 1% (мас. / Об.) BSA в PBS в течение 30 минут образцы инкубировали с первичным антителом, разведенным в 1% BSA в PBS в соответствии с инструкциями производителя в течение 1 часа в увлажненной камере.Затем три 5-минутных промывки PBS сопровождались инкубацией во вторичном антителе, разведенном 1: 1000 в 1% BSA в PBS, в течение 1 часа. После последних трех 5-минутных промываний PBS покровные стекла помещали на предметные стекла с реагентом Prolong Gold Antifade с DAPI (Thermo Scientific). Если не указано иное, все этапы выполнялись при комнатной температуре. Репрезентативные изображения были записаны с помощью Leica SP8 с объективом × 63 и цифровым зумом 2,35 ×.

    Анализ пролиферации

    Клетки высевали в 96-луночные планшеты за день до начала эксперимента, чтобы позволить клеткам прикрепиться к планшету (5000 клеток на лунку).Один планшет использовали для каждого дня кривой пролиферации. В планшете для дня 0 была подготовлена ​​стандартная кривая известного числа клеток, количественно определенная с помощью автоматического счетчика клеток (TC20, Bio-Rad) (0–40 000 клеток на лунку). В определенное время дня среду из планшета 0 удаляли, клетки промывали PBS, PBS удаляли и планшеты хранили при –80 ° C. При необходимости на этом этапе начинали лечение на других пластинах. Планшет собирали каждый день в то же время, как описано выше.В конце кривой пролиферации содержание ДНК количественно определяли с использованием Hoechst 33258 (Cayman Chemical) в качестве заместителя числа клеток. Каждую лунку инкубировали со 100 мкл H 2 O в течение 1 ч при 37 ° C, а затем планшеты помещали при –80 ° C до замораживания. После оттаивания при 37 ° C в каждую лунку добавляли рабочий раствор красителя (100 мкл) так, чтобы конечная концентрация составляла 1 мкг / мл Hoechst 33258, 100 мМ NaCl, 10 мМ Tris-Cl, 10 мМ EDTA (pH 7,4). . Флуоресценцию измеряли с помощью планшет-ридера Tecan Infinite (возбуждение 350 нм, эмиссия 455 нм).Контрольное значение вычитали, и кривую пролиферации рассчитывали, используя стандартную кривую с дня 0.

    Мембраны, устойчивые к моющим средствам

    Клетки собирали трипсином, промывали PBS и инкубировали в течение 30 минут на льду в 1,2 мл буфера для лизиса. (0,25 М сахароза, 20 мМ Трис-HCl pH 7,8, 1 мМ хлорид магния, 1 мМ хлорид кальция, 1% (об. / Об.) Тритон X-100) с добавлением коктейля ингибиторов протеазы (Roche). Устойчивые к моющим средствам мембраны выделяли из постнуклеарного супернатанта с использованием прерывистых градиентов Opti-Prep, как описано ранее 79,80 .После ультрацентрифугирования при 100000 × g в течение 16 ч градиенты были разделены на фракции по 1 мл, собранные с помощью поршневого градиентного фракционатора. Каждую фракцию концентрировали осаждением TCA 81 , и осадки белка растворяли в 100 мкл 2x загрузочного буфера Laemmli при 95 ° C. Выделение РНК

    и количественная ПЦР.

    РНК

    из культивированных клеток выделяли с использованием реагента TRIzol (Invitrogen) в соответствии с инструкциями производителя. Для получения кДНК использовали обратную транскриптазу Maxima H Minus (Thermo Scientific) в сочетании с праймерами oligo (dT) 18 в соответствии с протоколом, предоставленным производителем.Количественная ПЦР в реальном времени была проведена с использованием смеси Maxima SYBR Green / ROX qPCR Master Mix (Thermo Scientific) и мРНК-специфичных праймеров, перечисленных в дополнительных данных 2. Из обнаруженных Ct значения соответствующих 2 — Δ Ct или 2 — ΔΔ Ct значений. Если не указано иное, экспрессия гена нормализована до ACTB .

    Градиенты сахарозы для разделения белков мембраны

    Клетки собирали трипсином, промывали PBS и ресуспендировали в 2 мл буфера для лизиса (0.25 M сахарозы, 1 мМ сульфата магния, 10 мМ Tris-HCl pH 7,5) с добавлением коктейля ингибиторов протеазы (Roche). Затем клеточную суспензию гомозенизировали с помощью охлажденного гомогенизатора Dounce glas-glas (10 движений свободным пестиком, а затем 30 движений плотным пестиком). Гомогенат центрифугировали 5 мин при 600 × g при 4 ° C. Постнуклеарный супернатант переносили в новую пробирку, и осадок повторно гомогенизировали в 2 мл лизирующего буфера (50 движений плотным пестиком).После центрифугирования супернатанты объединяли; объем доводили до 6 мл и наносили на подушку из сахарозы (6 мл 75% (мас. / об.) сахарозы в 10 мМ Трис-HCl, pH 7,5). После 40 мин центрифугирования при 100000 × g при 4 ° C с использованием ультрацентрифуги Beckman (поворотный ротор SW 40 Ti) мембранную фракцию собирали с поверхности раздела сахарозной подушки и клеточного гомогената, доводили до 50% сахарозы в 2 мл и загружают в нижнюю часть прерывистого градиента сахарозы (снизу вверх: 1.35 мл 45% сахарозы, 1,8 мл 40% сахарозы, 1,8 мл 35% сахарозы, 1,8 мл 30% сахарозы, 1,8 мл 25% сахарозы в 10 мМ Трис-HCl pH 7,5). Градиенты ультрацентрифугировали в течение 4 ч при 150 000 × g при 4 ° C с использованием ультрацентрифуги Beckman (поворотно-откидной ротор SW 40 Ti). После ультрацентрифугирования фракции объемом 1 мл собирали с помощью поршневого градиентного фракционатора. Каждую фракцию концентрировали осаждением TCA 81 , и осадки белка растворяли в 100 мкл 2x загрузочного буфера Laemmli при 95 ° C.

    Определение ацил-КоА в клетках с помощью ЖХ-МС / МС

    Ацил-КоА (полярные липиды Avanti), используемые в качестве стандартов или для калибровки, разбавляли до 5 мкМ в смеси метанол / вода 1: 1 (об: об), содержащей 0,1 % гидроксид аммония. Растворители класса ЖХ-МС использовали для экстракций и МС-анализов. Пентадеканоил-кофермент A (C15: 0-CoA) и 10Z-гептадеценоил-кофермент A (C17: 1 (n7) -CoA) использовали в качестве внутренних стандартов. Кроме того, калибровочная смесь стандартов пальмитоил-кофермента A (C16: 0-CoA), стеароил-кофермента A (C18: 0-CoA) и 9Z-октадеканоил-кофермента A (C18: 1 (n9) -CoA) была использована для получения стандартов. калибровочные кривые.Ацил-КоА экстрагировали с использованием однофазной экстракции, как описано 82 . Экстракцию липидов проводили при 4 ° C в пробирках Eppendorf Safelock. 100 пмоль каждого внутреннего стандарта добавляли либо к клеткам, либо к калибровочной смеси. Клетки выращивали в 10-см культуральных чашках до ~ 90% конфлюэнтности и инкубировали с жирными кислотами, конъюгированными с БСА (конечная концентрация 100 мкМ) в течение 3 часов. После обработки клетки на каждом планшете быстро промывали PBS и соскребали с 500 мкл метанола / гидрокарбоната аммония 155 мМ 1: 1 (об: об).Затем лизат переносили в пробирку и быстро замораживали в жидком азоте. Отдельные планшеты / образцы были полностью обработаны от промывки до замораживания один за другим. Для экстракции использовали до 200 мкл каждого лизата, добавляя метанол / вода 1: 1 (об: об), содержащий 0,1% аммиака, до конечного объема 200 мкл. Количество образцов было скорректировано на основе количества фосфатидилхолина (см. Ниже). Обычно ~ 200 мкл 270 мкМ раствора ПК подвергали экстракции на ацил-КоА. Для стандартных титров: 0, 12.5, 25, 50, 75 и 100 пмоль калибровочной смеси переносили в отдельные пробирки с помощью шприцев Hamilton. Четыреста микролитров 155 мМ раствора гидрокарбоната аммония добавляли либо в пробирки для образцов, либо в стандартные пробирки, затем добавляли 300 мкл ацетонитрила и 100 мкл изопропанола. Образцы встряхивали, обрабатывали ультразвуком в ледяной бане и инкубировали при 950 об / мин на смесителе Eppendorf Thermo C в течение каждых 30 с при 4 ° C. Эта процедура повторялась трижды. После этого пробирки центрифугировали при 20 800 × g при 4 ° C в течение 10 мин в настольной центрифуге.Супернатанты переносили в 2 мл пробирки Эппендорфа. Оставшиеся гранулы подвергали одной повторной экстракции. Объединенные супернатанты упаривали в системе Centrivap при пониженном давлении при 30 ° C. Твердые остатки восстанавливали в 500 мкл смеси метанол / вода 1: 1 (об: об), содержащей 0,1% гидроксида аммония, обрабатывали ультразвуком и кратковременно встряхивали на льду. Раствор центрифугировали при 20,800 × g при 4 ° C в течение 10 мин. Супернатанты переносили в новые пробирки Эппендорфа объемом 1,5 мл.100 мкл этого раствора переносили во входные отверстия для силанизированного стекла в стеклянных флаконах и подвергали автосэмплеру (SIL-30AC) системы Nexera X2 UHPLC (Shimadzu), соединенному с QTRAP 6500 + (Sciex).

    Хроматографическое разделение выполняли, как описано 82 , с использованием колонки Waters ACQUITY UHPLC BEH C8 (130 Å, 1,7 мкм, 2,1 × 100 мм), включая предварительную колонку 5 мм аналогичного химического состава. Температуру термостата колонки устанавливали на 35 ° C и вводили 5 мкл. Градиент разделения был установлен на A (вода, содержащая 15 мМ гидроксида аммония) и B (ацетонитрил, содержащий 15 мМ гидроксида аммония) с расходом 0.4 мл / мин. Градиент начинали с 5% B в течение 1 минуты, затем увеличивали до 37% от 1 до 5 минут, до 60% от 5 до 11 минут. В течение 0,5 мин градиент был установлен на 100% B. С 14,5 до 15 минут градиент был возвращен к исходным условиям 5% B, с последующим 3-минутным временем уравновешивания до 18 минут. Для параметров МС и переходов MRM см. Дополнительные данные 3. Площади пиков оценивали с помощью Analyst 1.6.3 (Sciex). Концентрации ацил-КоА рассчитывали на основе интенсивности внутреннего стандарта C17: 1 (n7) -CoA и анализа линейной регрессии в точках калибровки.Для нормализации данных концентрации ацил-КоА были нормализованы к общему количеству ПК в виде липидов основной мембраны. Для количественного определения общего PC клетки подвергали экстракции липидов с использованием кислотной жидкостно-жидкостной экстракции 83 с использованием 25 пмоль PC (PC 13: 0/13: 0, PC 14: 0/14: 0, PC 20: 0). / 20: 0, PC 21: 0/21: 0, каждый 25 пмоль; Avanti Polar Lipids) в качестве смеси внутреннего стандарта. Конечную фазу CHCL 3 упаривали в слабом потоке азота при 37 ° C. Экстракты ресуспендировали в 10 мМ ацетате аммония в 60 мкл метанола.Аликвоты ресуспендированных липидных экстрактов по пять микролитров перед измерением разбавляли 1: 4 в 10 мМ ацетате аммония в метаноле в 96-луночных планшетах (Eppendorf twin tec 96). Измерения выполняли на QTRAP 5500 (Sciex), с введением электроспрея на основе чипа (HD-D ESI Chip, Advion Biosciences) и ионизацией с помощью Triversa Nanomate (Advion Biosciences). Виды ПК анализировали, используя сканирование ионов-предшественников (PREC 184, отбор для головной холинфосфатной группы), как описано 84 .Количество эндогенных молекулярных липидов рассчитывали на основе интенсивностей внутренних стандартов, и соответствующие интенсивности липидов экстрагировали с помощью LipidView (Sciex). Дополнительные сведения, включая параметры прибора, исходные данные и калибровочные кривые, приведены в дополнительных данных 1.

    Статистический анализ

    Статистический анализ был выполнен с использованием программного обеспечения GraphPad Prism 8.

    Подготовка рисунков

    Рисунки были подготовлены с помощью GIMP (https: // www.gimp.org/) и Affinity Designer (https://affinity.serif.com/en-gb/).

    Сводка отчетов

    Дополнительная информация о дизайне исследований доступна в Сводке отчетов по исследованиям природы, связанной с этой статьей.

    Том 10, № 23 | Азиатские социальные науки

    • На главную
    • Журналы
    • Азиатские социальные науки
    • Архивы
    • Том. 10, № 23 (2014)

    Т. 10, № 23 (2014), Asian Social Science

      • Роль экологического маркетинга в формировании и развитии экологического кластера
        • Елена Попкова
        • Юлия Дубова
        • Елена Яковлева
        • Елена Титова
        • p1
        • PDF
      • Внутриполитические и международные аспекты регулирования теневого сектора как угроза экономической безопасности
        • Ольга Степичева
        • Владислав Юрьев
        • p9
      • Исследование предпринимательских структур Эффективность управления лесным хозяйством лесной системы в малолесном бедном регионе
        • Светлана Морковина
        • Ирина Сибиряткина
        • Ирина Сибиряткина
        • Елеся стр.20

        • PDF
      • О прогрессивной системе налогообложения оплаты труда в России
        • Марат Ибрагимов
        • Рустам Ибрагимов
        • 2

          3
      • Вопросы достаточности потенциальных нефтяных ресурсов для поддержания текущей добычи нефти
        • Шамиль Валитов
        • Айдар Туфетулов
        • 9673 9243000 pdf 9205
      • Расширение возможностей для частного бизнеса как вектор направления развития экономики России (на примере Волгоградской области)
        • Лариса Шаховская
        • Ксения Климкова 9044
        • 9024
      • Содержание и структура инновационной деятельности в экономике России
        • Елена Сибирская
        • Олеся Строева
        • Надежда

          000 9673
      • Применение потоковых методов управления материальными и финансовыми ресурсами для прогнозирования нефтедобычи в России
        • Айдар Туфетулов
        • Шамиль Валитов
        • 2

          9000 pdf
      • Российский рынок сельскохозяйственной техники: вызовы и возможности
        • Ирина Морозова
        • Татьяна Литвинова
        • p68
        • PDF
      • Необходимость единой информационной платформы Формирование «Инновации России»
        • Елена Сибирская
        • Олеся Строева
        • Надежда 9673000 п. PDF
      • Разработка методологических подходов к анализу эффективности формирования территориально-отраслевого кластера в лесном хозяйстве
        • Светлана Морковина
        • Елена Попкова
        • Елена Попкова
        • Сантемалова
          • p85
          • PDF
        • Механизмы поддержки экспортно-ориентированных малых предприятий: региональный аспект
          • Юля Бусарина
          • Светлана Морковина
          • Светлана
          • 00020002 Будкова
          • PDF
        • Экономическая уверенность как фактор управления финансовой стабильностью российских банков в условиях геополитических рисков
          • Алина Андреева
          • p102
          • PDF
        • Социально-экономическая роль предпринимательских университетов в развитии инновационных кластеров: пример России
          • Ольга Корженевская
          • p113
        • Маркетинговый механизм определения потребительского спроса на экологическую продукцию
          • Ульяна Позднякова
          • Лариса Пономарева
          • 3

            3 Вячеслав Лапшин 9675
          • 3 Вячеслав Лапшин 9675

          • PDF
        • Потребность в государственном регулировании экологически чистых продуктов питания
          • Владимир Жидков
          • Андрей Храмцов
          • Жанна Горностаева
          • Жанна Горностаева
          • 9675 Екатерина
          • Екатерина 96750003
          • PDF
        • Обновление основных производственных активов: инструменты стимулирования
          • Мария Мерзлова
          • p144
          • PDF
        • Улучшение банковских услуг за счет развития сервисных технологий
          • Татьяна Зайцева
          • Геннадий Буряков
          • Жанна Горностаева
          • Жанна Горностаева
          • pdf

        • Развитие мирового рынка услуг в условиях глобализации: институциональные и сетевые подходы
          • Инесса Ефременко
          • Татьяна Панасенкова
          • PDF
        • Механизм развития сельского предпринимательства на основе микробизнеса
          • Татьяна Забазнова
          • Светлана Карпушова
          • Елена
          • Пацюк Елена
          • Суркова
          • Галина Хмелева
          • p168
          • PDF
        • Проблема сохранения национального государственного суверенитета в условиях глобализации
          • Адам Альбеков
          • Анна Полуботко
          • 2

            Анна Полуботко
          • 2

            Елена

            9000 pdf
        • Современная практика использования инструментов налогового регулирования
          • Мария Троянская
          • Юлия Тюрина
          • p184
          • PDF
          • PDF
        • Управление рисками венчурного предпринимательства
          • Елена Лопатина
          • Кристина Целых
          • Елена Чугунова
          • Елена Чугунова
          • 2

        • Коллективизм и индивидуализм в современной России
          • Владимир Мамонтов
          • Татьяна Кожевникова
          • Яна Радюкова

      • Описательный анализ внедрения инновационных технологий в лесное хозяйство
        • Олег Корчагин
        • Ирина Зиновьева
        • Юлия Попова
        • Юлия Попова 9205 p000
      • Государственная поддержка создания и развития социально ориентированных инновационных предприятий
        • Валентина Парахина
        • Ольга Борис
        • Татьяна Безрукова

        • PDF
      • Функционирование и развитие целевых капиталов некоммерческих организаций
        • Елена Бокарева
        • Людмила Черникова
        • Елена Егорова

          0 9673

        • Егорова 9673
      • Комплексная оценка инвестиционного потенциала (на примере Южного федерального округа)
        • Наталья Косинова
        • Марина Толстел
        • Анна Чекалкина
      • Актуальные проблемы развития системы высшего образования Российской Федерации: институциональные аспекты
        • Владимир Чащин
        • p244
        • PDF
      • Лояльность потребителей как фактор установления конкурентных преимуществ компании в рыночных условиях
        • Алина Чеснокова
        • Оксана Радина
        • 45
        • 45 PDF

    Эта работа находится под лицензией Creative Commons Attribution 4.0 Лицензия.

    Фамилия Серебрякова

    имена для Серебряковой

    • Виктория Серебрякова 4
    • Irishka Серебрякова 4
    • Ирина Серебрякова 4
    • Инна Серебрякова 4
    • Inga Серебрякова 4
    • Инесса Серебрякова 4
    • Елена Серебрякова 4
    • Галина Серебрякова 4
    • Елена Серебрякова 4
    • Юлия Серебрякова 3
    • Таня Серебрякова 3
    • Светлана Серебрякова 3
    • Ольга Серебрякова 3
    • Наталья Серебрякова 3
    • Наталия Серебрякова 3
    • Дарья Серебрякова 3
    • Зоя Серебрякова 2
    • Женя Серебрякова 2
    • Жанна Серебрякова 2
    • Юля Серебрякова 2
    • Юлия Серебрякова 2
    • Юленька Серебрякова 2
    • Елена Серебрякова 2
    • Яна Серебрякова 2
    • Виолетта 9000 9000 Серебрякова
    • 000 Виолетта
    • 000 Виолетта
    • 000 Серебрякова Виктория
    • 000 9000 9000 Викториа Серебрякова 2000 риа Серебрякова 2
    • Вероника Серебрякова 2
    • Вера Серебрякова 2
    • Василиса Серебрякова 2
    • Валерия Серебрякова 2
    • Валентина Серебрякова 2
    • Uliya Серебрякова 2
    • Тина Серебрякова 2
    • Татьяна Серебрякова 2
    • Татьяна Серебрякова 2
    • Танюшка Серебряков 2
    • Тамара Серебрякова 2
    • Светка Серебрякова 2
    • Станислава Серебряков 2
    • Соня Серебрякова 2
    • Снежана Серебрякова 2
    • Саша Серебрякова 2
    • Полины Серебрякова 2
    • Оксаны Серебрякова 2
    • Оля Серебрякова 2
    • Олеся Серебрякова 2
    • Оксана Серебрякова 2
    • Нина Серебрякова 2
    • Ника Серебрякова 2
    • Наташа Серебрякова 2
    • Наталья Серебрякова 2
    • Наталья Серебрякова 2
    • Серебрякова Наталья 2 ва 2
    • Nadya Серебрякова 2
    • Надежда Серебрякова 2
    • Милена Серебрякова 2
    • Мила Серебрякова 2
    • Майя Серебрякова 2
    • Маша Серебрякова 2
    • Мария Серебрякова 2
    • Марина Серебрякова 2
    • Мария Серебрякова 2
    • Marianna Серебрякова 2
    • Мариана Серебрякова 2
    • Маргарита Серебрякова 2
    • Людмила Серебрякова 2
    • Любовь Серебрякова 2
    • Lydmila Серебрякова 2
    • Людмила Серебрякова 2
    • Лизы Серебрякова 2
    • Лиля Серебрякова 2
    • Лилия Серебрякова 2
    • Лилия Серебрякова 2
    • Лера Серебрякова 2
    • Лена Серебрякова 2
    • Лариса Серебрякова 2
    • Ксюша Серебрякова 2
    • Ксения Серебрякова 2
    • Ксения Серебрякова 2
    • Ксения Серебры 2
    • Ксения Серебры 2 Ксения Серебры 2 ти Серебрякова 2
    • Катя Серебрякова 2
    • Кейт Серебрякова 2
    • Катерина Серебрякова 2
    • Карина Серебрякова 2
    • Julie Серебрякова 2
    • Юлия Серебрякова 2
    • Irinka Серебрякова 2
    • Ирена Серебрякова 2
    • Иоланта Серебрякова 2
    • Илона Серебрякова 2
    • Ильмир Серебряков 2
    • Галя Серебрякова 2
    • Галя Серебрякова 2
    • Евгений Серебряков 2
    • Евгений Серебряков 2
    • Елизавета Серебрякова 2
    • Елизабет Серебрякова 2
    • Екатерина Серебрякова 2
    • Diana Серебрякова 2
    • Дашка Серебрякова 2
    • Даша Серебрякова 2
    • Дарья Серебрякова 2
    • Кристина Серебрякова 2
    • Ася Серебрякова 2
    • Ася Серебрякова 2
    • Арина Серебрякова 2
    • Аня Серебрякова 2
    • Аня Серебрякова 2
    • Аня Серебрякова 2
    • Аня Серебрякова 2 0005
    • Энн Серебрякова 2
    • Анна Серебрякова 2
    • Ангелина Серебрякова 2
    • Анастасия Серебрякова 2
    • Анастасия Серебрякова 2
    • Алена Серебрякова 2
    • Алла Серебрякова 2
    • Алена Серебрякова 2
    • Алина Серебрякова 2
    • Альфия Серебрякова 2
    • Александра Серебрякова 2
    • Алевтина Серебрякова 2
    • Алена Серебрякова 2
    • Александра Серебрякова 2
    • Зося Серебрякова
    • Злата Серебрякова
    • Зинаиды Серебряковой
    • Зиля Серебрякова
    • Женечка Серебрякова
    • Yulua Серебрякова
    • Yullis Серебрякова
    • Юлианна Серебрякова
    • Юлиана Серебрякова
    • Юлиана Серебрякова
    • Евгения Серебрякова
    • Яночка Серебрякова
    • Крис Серебрякова
    • Владрыслава Виктория 2 Rija Серебрякова
    • Валерия Серебрякова
    • Валерий Серебрякова
    • Valeriia Серебрякова
    • Валери Серебрякова
    • Ульяна Серебрякова
    • Уля Серебрякова
    • Teshka Серебрякова
    • Тая Серебрякова
    • Татьянка Серебрякова
    • Тата Серебрякова
    • Таша Серебрякова
    • Таисия Серебрякова
    • Svetulik Серебряков
    • Стася Серебряков
    • Stacy Серебрякова
    • Soupha Серебрякова
    • Sophi Серебрякова
    • Софии Серебряков
    • Sofi Серебрякова
    • Софии Серебрякова
    • Снежаны Серебрякова
    • Сергея Серебряков
    • Sashulya Серебряков
    • Сашенька Серебрякова
    • Сарви Серебрякова
    • Сария Серебрякова
    • Сабелла Серебрякова
    • Рассел Серебрякова
    • Роза Серебрякова Kova
    • Роза Серебрякова
    • Рита Серебрякова
    • Римма Серебрякова
    • Рената Серебрякова
    • Оленька Серебрякова
    • Ниночка Серебрякова
    • Никол Серебрякова
    • Nehir Серебрякова
    • Natusik Серебрякова
    • Nathalia Серебрякова
    • Nataxa Серебрякова
    • Natashaa Серебрякова
    • Nataliia Серебрякова
    • Настюшка Серебрякова
    • Настюша Серебрякова
    • Nastyuhsa Серебрякова
    • Настя Серебрякова
    • Наста Серебрякова
    • Nanataliy Серебрякова
    • Наиля Серебрякова
    • Надюша Серебрякова
    • Надя Серебрякова
    • Надежда Серебрякова
    • Надежда Серебрякова
    • Modesta Серебрякова
    • Машуня Серебрякова
    • Машенька Серебрякова
    • Мария Серебрякова
    • Маруся С erebryakova
    • Maruska Серебрякова
    • Марта Серебрякова
    • Mariwa Серебрякова
    • Марго Серебрякова
    • Марены Серебрякова
    • Manishe Серебрякова
    • Людочка Серебрякова
    • Люба Серебрякова
    • Lusi Серебрякова
    • Luiza Серебрякова
    • Любовь Серебрякова
    • Людмила Серебрякова
    • Люд Серебряков
    • Любови Серебряков
    • Лины Серебрякова
    • Лили Серебряков
    • Лили Серебрякова
    • Лика Серебряков
    • Лейлы Серебрякова
    • Лел Серебряков
    • Lesechka Серебрякова
    • Леночке Серебряков
    • Ленько Серебрякова
    • Лелик Серебрякова
    • Ларисы Серебрякова
    • Лада Серебрякова
    • Ксюшка Серебрякова
    • Ксюша Серебрякова
    • Кристи Серебрякова
    • Kristinka Серебрякова
    • Красимира Серебрякова
    • Kira Серебрякова
    • Ketty Серебрякова
    • Katrin Серебрякова
    • Екатерина Серебрякова
    • Кант Серебрякова
    • Камиля Серебрякова
    • Июль Серебрякова
    • Julya Серебрякова
    • Juliya Серебрякова
    • Juli Серебрякова
    • Julietta Серебрякова
    • Джулианна Серебрякова
    • Джейн Серебрякова
    • Irtna Серебрякова
    • Гульнара Серебрякова
    • Фаня Серебрякова
    • Эвелина Серебрякова
    • Евгений Серебрякова
    • Эльвира Серебрякова
    • Elina Серебрякова
    • Ehmma Серебрякова
    • Ehlla Серебрякова
    • Элина Серебрякова
    • Доминика Серебрякова
    • Динара Серебрякова
    • Дашута Серебрякова
    • Дашу Серебрякова
    • Дари Се rebryakova
    • Дарина Серебрякова
    • Кристи Серебрякова
    • Екатерина Серебрякова
    • Caterina Серебрякова
    • Каролина Серебрякова
    • Bella Серебрякова
    • Аурика Серебрякова
    • Ариша Серебрякова
    • Anzhelika Серебрякова
    • Анютка Серебрякова
    • Anka Серебрякова
    • Angella Серебрякова
    • Анфиса Серебрякова
    • Анечка Серебрякова
    • Andjali Серебрякова
    • Anastssija Серебрякова
    • Анастасий Серебрякова
    • Алиша Серебрякова
    • Алиса Серебрякова
    • Алиночка Серебрякова
    • Алинка Серебрякова
    • Альфира Серебрякова
    • Александрина Серебрякова
    • Alexandera Серебрякова
    • Алеся Серебрякова
    • Аиша Серебрякова

    Опечатки

    Серебряквоа, шребрякова, провидец bryakova, serebryakov, serebryakovaa, serebryskovs, seebeyakova, serebryakovae, serebryakovai, serebryakovao

    Лучшие изображения для Серебряковой

    Кластеризация как точка роста современного российского бизнеса

    Автор

    Включено в список:
    • Елена Г.Попкова

      (Волгоградский государственный технический университет)

    • Тюрина Юлия Григорьевна

      (Оренбургский государственный университет)

    • Созинова Анастасия Анатольевна

      (Вятский государственный университет)

    • Бычкова Лариса Владимировна

      (Юго-Западный государственный университет)

    • Земскова Ольга Михайловна

      (Волгоградский государственный аграрный университет)

    • Серебрякова Мария Федоровна

      (Волгоградский государственный аграрный университет)

    • Лазарева Наталья Владимировна

      (Северо-Кавказский федеральный университет)

    Реферат

    Статья посвящена роли кластеризации в развитии современного российского бизнеса.Авторы анализируют динамику основных параметров развития малого и среднего бизнеса в современной России, выявляют проблемы и перспективы развития бизнеса. Авторы предлагают и доказывают гипотезу о том, что кластеризация — это точка роста современного российского бизнеса.

    Предлагаемое цитирование

  • Елена Г. Попкова, Юлия Г. Тюрина, Анастасия А. Созинова, Лариса В. Бычкова, Ольга М. Земскова, Мария Ф. Серебрякова, Наталья В. Лазарева, 2017.« Кластеризация как точка роста современного российского бизнеса ,» Вклад в экономику, в: Елена Г. Попкова, Валентина Е. Сухова, Алексей Ф. Рогачев, Юлия Г. Тюрина и Ольга А. Борис и В. (ред.), Интеграция и кластеризация для устойчивого экономического роста, страницы 55-63, Springer.
  • Рукоятка: RePEc: spr: conchp: 978-3-319-45462-7_7
    DOI: 10.1007 / 978-3-319-45462-7_7

    Загрузить полный текст от издателя

    Насколько нам известно, этот элемент недоступен для скачать .Чтобы узнать, доступен ли он, есть три варианты:
    1. Проверьте ниже, доступна ли в Интернете другая версия этого элемента.
    2. Зайдите на страницу провайдера действительно ли он доступен.
    3. Выполните поиск элемента с таким же названием, который был бы доступный.

    Исправления

    Все материалы на этом сайте предоставлены соответствующими издателями и авторами. Вы можете помочь исправить ошибки и упущения. При запросе исправления, пожалуйста, укажите идентификатор этого элемента: RePEc: spr: conchp: 978-3-319-45462-7_7 .См. Общую информацию о том, как исправить материал в RePEc.

    По техническим вопросам, касающимся этого элемента, или для исправления его авторов, заголовка, аннотации, библиографической информации или информации для загрузки, обращайтесь:. Общие контактные данные провайдера: http://www.springer.com .

    Если вы создали этот элемент и еще не зарегистрированы в RePEc, мы рекомендуем вам сделать это здесь. Это позволяет привязать ваш профиль к этому элементу. Это также позволяет вам принимать потенциальные ссылки на этот элемент, в отношении которых мы не уверены.

    У нас нет библиографических ссылок на этот товар. Вы можете помочь добавить их, используя эту форму .

    Если вам известно об отсутствующих элементах, цитирующих этот элемент, вы можете помочь нам создать эти ссылки, добавив соответствующие ссылки таким же образом, как указано выше, для каждого ссылочного элемента. Если вы являетесь зарегистрированным автором этого элемента, вы также можете проверить вкладку «Цитаты» в своем профиле службы авторов RePEc, поскольку там могут быть некоторые цитаты, ожидающие подтверждения.

    По техническим вопросам, касающимся этого элемента, или для исправления его авторов, названия, аннотации, библиографической информации или информации для загрузки, обращайтесь: Sonal Shukla или Springer Nature Abstracting and Indexing (адрес электронной почты указан ниже).Общие контактные данные провайдера: http://www.springer.com .

    Обратите внимание, что исправления могут занять пару недель, чтобы отфильтровать различные сервисы RePEc.

    .

    Have any Question or Comment?

    Добавить комментарий

    Ваш адрес email не будет опубликован. Обязательные поля помечены *